KEGG   Mus musculus (mouse): 75581
Entry
75581             CDS       T01002                                 

Symbol
Yipf7, 2310016N21Rik, Yip1b
Name
(RefSeq) Yip1 domain family, member 7
  KO
K20363  protein YIPF5/7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    75581 (Yipf7)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   YIPF proteins
    75581 (Yipf7)
SSDB
Motif
Pfam: Yip1
Other DBs
NCBI-GeneID: 75581
NCBI-ProteinID: NP_076273
MGI: 1922831
Ensembl: ENSMUSG00000029158
Vega: OTTMUSG00000022940
UniProt: Q9JIM5
Position
5; 5 C3.1
AA seq 254 aa
MSNPEQYDMGFYQSNYIIDNQEPSCNDSNAYGNVYGYREPQATEQPSSPAPPEMFLPSDY
GGQLFQPASNLDYYSQSPSVDTFDEEPPLLEELGINFDHIWQKTLTVLNPMKPADGSIMN
ETDLTGPILFCVALGATLLMAGKAQFGYVYGMSAIGCLGIHALLNLMSNSGVSYGCVASV
LGYCLLPMVLLSSCAVFFSLQGTIGTMSALLIITWCSLSASKIFISALAMEGQQLLVAYP
CALLYGLFALLTVF
NT seq 765 nt   +upstreamnt  +downstreamnt
atgtcaaacccagaacagtatgacatgggcttctaccaatctaattatatcattgataat
caggagccgagttgcaatgattctaatgcttatggaaatgtttatggatacagagagcca
caagccactgagcagccttcctctccagctccaccagagatgttcctgccatcagattac
ggagggcagctttttcagccagcatccaacttggattattactcacagtctccctcagtt
gacacttttgatgaagagccccctttgctagaggaacttggaattaattttgatcacata
tggcagaaaaccttgacggtgctaaacccaatgaagccagcagatggcagcatcatgaat
gaaacggatctcacaggacccatccttttctgtgtggctctgggagccacattgcttatg
gctggaaaagcccagtttggttatgtatacggcatgagtgccattggctgccttgggatt
cacgccttactgaacttgatgagcaactccggggtgtcatatggctgtgtggccagtgtg
ctgggatactgcttgctccccatggtcctcttgtccagctgtgcagtcttcttttcactg
cagggtaccataggaaccatgtcagccctgctcatcattacctggtgcagtctctcagct
tctaagatcttcatttcggccttggccatggaaggacagcagcttcttgtcgcttacccc
tgtgccttactttatggactctttgcccttctgaccgttttctaa

DBGET integrated database retrieval system