KEGG   Mus musculus (mouse): 75608Help
Entry
75608             CDS       T01002                                 

Gene name
Chmp4b, 2010012F05Rik, C76846, Snf7-2
Definition
(RefSeq) charged multivesicular body protein 4B
  KO
K12194  charged multivesicular body protein 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04217  Necroptosis
Module
mmu_M00412  ESCRT-III complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    75608 (Chmp4b)
  09143 Cell growth and death
   04217 Necroptosis
    75608 (Chmp4b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    75608 (Chmp4b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    75608 (Chmp4b)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    75608 (Chmp4b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   75608 (Chmp4b)
  Exosomal proteins of other body fluids (saliva and urine)
   75608 (Chmp4b)
  Exosomal proteins of colorectal cancer cells
   75608 (Chmp4b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7 SYF2 WD-3 Exonuc_VII_L
Motif
Other DBs
NCBI-GeneID: 75608
NCBI-ProteinID: NP_083638
MGI: 1922858
Ensembl: ENSMUSG00000038467
Vega: OTTMUSG00000015914
UniProt: Q9D8B3
Position
2; 2 H1
AA seq 224 aa AA seqDB search
MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTK
NKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH
DNMDIDKVDELMQDIADQQELAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNL
LEISGPETVPLPNVPSVALPSKPAKKKEEEDDDMKELENWAGSM
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgttcgggaagctgttcggggctggagggggtaaggcgggcaagggcggcccg
accccccaggaggccatccagcggcttcgggacacggaggagatgttaagcaagaagcag
gagttcctggagaagaaaatcgaacaggagctgacggctgccaagaagcacggcaccaaa
aataaacgcgccgccctgcaggctctgaagcgcaagaagaggtatgagaagcagctggca
caaattgatggcaccctgtcaaccatcgagttccagcgggaggccctagagaacgccaac
accaacacggaggtgctcaagaacatgggctatgccgccaaggccatgaaggctgcccac
gacaacatggacattgataaggtggatgagttaatgcaggacattgctgaccagcaagaa
cttgcagaggagatttccacagctatctccaaacctgtgggctttggagaagagttcgac
gaggatgagctcatggcagagttggaggaacttgaacaagaggagttggacaagaatttg
ttggagatcagtgggcccgaaacagtccctctaccaaatgtcccctccgtagccctacca
tccaaacccgccaagaagaaggaagaggaagatgacgacatgaaggaattggagaactgg
gccggatccatgtaa

DBGET integrated database retrieval system