KEGG   Mus musculus (mouse): 75616Help
Entry
75616             CDS       T01002                                 

Gene name
Smim15, 2810008M24Rik
Definition
(RefSeq) small integral membrane protein 15
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: UPF0542 FxsA TMEM100 OAD_gamma
Motif
Other DBs
NCBI-GeneID: 75616
NCBI-ProteinID: NP_001041715
MGI: 1922866
Ensembl: ENSMUSG00000071180
UniProt: Q3UTD9
Position
13; 13 D2.1
AA seq 74 aa AA seqDB search
MLDIKAWAEYVVEWAAKDPYGFLTTVILALTPLFLASAVLSWKLAKMIEAREKEQKKKQK
RQENIAKAKRLKKD
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacataaaggcttgggctgagtatgttgtggagtgggctgcaaaggacccatat
ggcttccttaccacagttatcttggcgctcacaccactgttcctagctagtgctgtactg
tcctggaagttggccaagatgattgaagccagagagaaggagcaaaagaagaaacaaaaa
cggcaagaaaacatcgcaaaagctaaacgactaaagaaggattga

DBGET integrated database retrieval system