KEGG   Mus musculus (mouse): 75669
Entry
75669             CDS       T01002                                 

Gene name
Pik3r4, 2210010O15Rik, C730038E05Rik, C85833, D9Ertd418e, Vp, Vps15, p15, p150
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 4
  KO
K08333  phosphoinositide-3-kinase, regulatory subunit 4 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04136  Autophagy - other
mmu04140  Autophagy - animal
mmu04371  Apelin signaling pathway
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    75669 (Pik3r4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    75669 (Pik3r4)
   04136 Autophagy - other
    75669 (Pik3r4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    75669 (Pik3r4)
   05014 Amyotrophic lateral sclerosis
    75669 (Pik3r4)
   05016 Huntington disease
    75669 (Pik3r4)
   05017 Spinocerebellar ataxia
    75669 (Pik3r4)
   05022 Pathways of neurodegeneration - multiple diseases
    75669 (Pik3r4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    75669 (Pik3r4)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    75669 (Pik3r4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     75669 (Pik3r4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  VPS15 family
   75669 (Pik3r4)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    75669 (Pik3r4)
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    75669 (Pik3r4)
SSDB
Motif
Pfam: Pkinase WD40 HEAT PK_Tyr_Ser-Thr HEAT_2 IFRD
Other DBs
NCBI-GeneID: 75669
NCBI-ProteinID: NP_001074778
MGI: 1922919
Ensembl: ENSMUSG00000032571
Vega: OTTMUSG00000049417
UniProt: Q8VD65
Position
9 F1; 9 56.79 cM
AA seq 1358 aa
MGNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKHREGLVVVKVFAIQDP
TLPLTSYKQELEELKIRLHSAQNCLPFQKAAEKASEKAAMLFRQYVRDNLYDRISTRPFL
NNIEKRWIAFQILTAVDQAHKSGVRHGDIKTENVMVTSWNWVLLTDFASFKPTYLPEDNP
ADFNYFFDTSRRRTCYIAPERFVDGGMFATELEYMRDPSTPLVDLNSNQRARGELKRAMD
IFSAGCVIAELFTEGVPLFDLSQLLAYRNGHFFPEQVLNKIEDRSIRDLVTQMINREPEK
RLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSADERILVIRKDLGNIIHNLCGH
DLPEKAEGESRASGLVVLVSVITSCLQTLKSCDSKLAALELILHLAPRLSVEILLDRITP
YLLHFSNDSVPRVRAEALRTLTKVLALVQEVPRNDVNIYPEYILPGIAHLAQDDATIVRL
AYAENIALLAETALRFLELVQLKTLNMENEPDNEEVDEATRPNGDYDTELQALHEMVQQK
VVTLLSDPENIVKQTLMESGITRLCVFFGRQKANDVLLSHMITFLNDKNDWHLRGAFFDS
IVGVAAYVGWQSSSILKPLLQQGLSDAEEFVIVKALNALTCMCQLGLLQKPHVYEFASDI
APFLCHPNLWIRYGAVGFITVVAHQISTADVYCKLMPYLDPYITQPVIQIERKLVLLSVL
KEPVSRSIFDYALRSKDIASLFRHLHMRQKKRNGSLLDCPPPEDPTIAQLLKKLLSQGMT
EEEEDKLLALKDFMMKSNRAKANAVDQSHLHDSSQKGVIDLAALGITGRQVDLVKTKQEP
DEKRARKHVKQDSNVNEEWKSMFGSLEPPNIPQALPKTSDHEVVQPGKPPRSESSAGICV
PLSTSPQVSEAAHIPSKKPVIPVVSSTVLPSTYQIRITTCKTELQQLIQQKREQCNAERI
AKQMMENAEWESKPPPPGWRPKGLLVAHLHEHKSAVNRIRVSDEHLLFATCSNDGTVKIW
NSQKMEGKTTTTRSILTYSRIGGRVKTLTFCQGSHYLAIASDNGAVQLLGIEASKLPKSP
KIHPLQSRILDQKEDGCVVDMHHFNSGAQSVLAYATVNGSLVGWDLRSSSNAWTLKHDLK
SGLITSFAVDIHQCWLCIGTSSGAMACWDMRFQLPISSHCHPSRARIRRLSMHPLYQSWV
IAAVQGNNEVSMWDMETGDRRLTLWASSAPPLSELQPSPHSVHGIYCSPADGNPILLTAG
SDMKIRFWDLVSPERSYVVAGSTGSPSVSYYKKIIEGTEVVQEIQNKQKVGPSDDTPRRG
PESLPVGHHDIITDIATFQTTQGFIVTASRDGIVKVWK
NT seq 4077 nt   +upstreamnt  +downstreamnt
atgggaaatcagctggctggcatcgctccttcccagatcctgtctgtagagagttatttc
tcagacatccatgactttgagtatgataagagcctgggaagcactcggttttttaaagtc
gctcgagccaagcaccgggaaggcctggtggttgtgaaggtctttgcaattcaggatccc
acgttacccttaactagttataaacaggagctggaggaactgaaaatcaggctccactcc
gcccagaactgcctccccttccagaaagcagcagaaaaggcgtctgagaaagcagccatg
ctgttccggcagtatgtgagagacaacctctacgatcgcatcagtacccgcccgttccta
aacaacatcgagaagcgctggatcgccttccagatcctgacggccgtggaccaagcgcac
aaatctggagtccgccacggagacatcaagacagagaatgtgatggtcaccagttggaac
tgggtcctcctaaccgacttcgccagttttaagcccacgtatcttcccgaggacaaccca
gcggatttcaactatttctttgacacctcgagaaggaggacatgctacatagctcccgag
cgcttcgttgacggtgggatgttcgccaccgagttagagtacatgagagacccctcaacc
ccgcttgtcgacctgaatagcaatcagagagcgcggggagagctgaagagagccatggac
atcttttcggcaggttgcgtgatagctgagctctttacggaaggcgtacctttgtttgat
ctctctcagctgctggcgtatagaaacggacattttttccctgaacaagtgctaaacaaa
attgaagatcgcagtatcagagacttggtaactcagatgattaaccgtgagcccgagaag
cgtttggaagctgaggactacctgaagcagcagcgaggcaacgccttccctgagatattt
tatactttccttcagccttacatggcccagttcgccaaggaaacctttctctctgcagat
gagcggattttggttatacggaaagatttgggcaacattattcacaacctctgtggacat
gatttgccagaaaaagcagaaggggagtccagggccagtggtctggttgtcctggtgtcc
gtgataacgtcctgcctgcagacactgaagtcctgcgactccaaactggccgccttggag
ctcatcctgcatctggcccccagactgagcgtcgagatccttctggatcgcatcactccc
tacctgttgcatttcagcaatgactctgtcccaagagtgcgggctgaagccctgaggaca
ctcaccaaagtccttgcccttgtccaagaggttcctcgcaacgatgtcaatatctatcca
gagtatattctccccggcatagcccacctggcccaggatgacgctaccatcgtcagactg
gcctacgctgaaaacatagctctgttggccgagacggctctgcgattcctggagcttgtg
cagctgaaaactctcaacatggagaacgagcccgataacgaggaggtagatgaagccacg
cgtcctaacggagactatgacacagagctccaggccttgcatgagatggtccagcagaag
gtggtcacgttgctaagcgaccctgagaatatcgtgaaacagacgctgatggagagtggg
atcacacgcttgtgcgtcttcttcggacgccagaaggccaacgacgttctcttgtcccac
atgatcactttcctcaatgataagaatgattggcacctgcgtggagctttctttgatagc
atagtcggtgtggctgcctacgttggctggcagagctcctctatcctcaagcccctgctc
cagcaaggcctcagcgatgctgaggagtttgtcatcgtgaaagctctcaatgccctgacc
tgcatgtgccagctagggctgctgcagaaaccccatgtctacgagttcgccagtgatatt
gctcccttcctgtgtcaccctaacctgtggatacgctatggcgctgtgggatttatcacg
gtggtagctcatcagatcagtactgctgatgtctactgcaagctcatgccgtatcttgac
ccgtatattacacagccagtgatacagattgagaggaagctggtcctgctcagtgtgcta
aaggagccggtgagccgctccatatttgactatgctctgaggtcgaaagacatcgccagc
ttgttcagacatctccacatgcgccagaagaagcgaaatggctctcttctcgactgccct
ccacctgaggaccccaccatagcgcaacttctgaagaagttgctctcacaggggatgact
gaagaagaggaagataaacttctggcactgaaggacttcatgatgaaatcaaatcgagcc
aaagctaatgcggtagaccagagccacctccacgacagcagccagaaaggtgtaatcgac
ttggccgccttaggcatcactgggagacaagttgatcttgttaaaaccaaacaagaacca
gatgagaaacgtgctaggaaacatgtgaaacaagactccaatgtaaatgaagagtggaaa
agcatgtttgggtcattggagccaccgaatatcccacaggccctgcctaaaaccagtgac
catgaggttgttcagcctgggaagccacctcgctctgagtcctctgctggtatctgtgtc
cctttgtcaacgtctccacaggtctcagaagcagctcacatcccaagtaagaagcctgtg
atcccggttgtgagtagcacggtcctgccgtccacttaccagatccgcatcaccacgtgc
aagactgaacttcagcagctcatacagcagaagagggagcagtgcaacgcggagcgcata
gccaagcagatgatggagaatgccgagtgggagagcaagccacctccacctgggtggcgt
cctaaagggctgctagttgcacatcttcatgagcacaaatctgctgtgaatcgcatcaga
gtctctgatgaacacttactttttgcaacatgttcaaatgatggcacagtgaagatctgg
aacagccagaagatggaggggaagaccaccacaacgcggtctattctcacgtacagccga
attggaggacgagtcaagacgctaacgttttgccaaggctcccactacttggccatagca
tctgataatggtgctgtccagcttcttggaattgaggcgtctaagttacccaagtctcct
aaaattcaccctctacaaagcaggattctggatcagaaggaagatggctgtgtggtggac
atgcatcacttcaactccggggcacagtccgttcttgcctatgccacggtgaatggctct
ctggttggatgggatctcaggtcttcaagcaacgcgtggacattaaagcatgacctaaag
tcaggcctcatcacttcctttgccgtggacatccaccagtgctggctgtgcataggcacg
agcagcggtgccatggcgtgttgggacatgaggttccagttgcccatctccagtcactgt
catccctccagagctcgcatccggcgcctctccatgcaccccctgtaccagtcctgggta
atcgcagctgttcagggcaacaatgaagtctccatgtgggacatggaaactggcgacagg
agactgactctctgggccagcagcgcaccgccactgtctgaattacagccttcaccgcac
agcgtccatggcatctactgcagccctgcagatggaaaccctatcctgctgaccgctggc
tcagacatgaaaataaggttctgggacttggtttccccagagaggtcctatgttgttgcg
ggaagtacaggttccccgtctgtctcctactacaagaagataatagaaggcaccgaggtc
gtccaggaaattcagaataagcagaaggttggaccgagtgatgatacccctcggaggggc
ccggagtctctgcctgtgggacatcatgacatcatcacagacattgccaccttccagacc
actcagggcttcattgtgactgcttctagagacggaattgtgaaggtgtggaaataa

DBGET integrated database retrieval system