KEGG   Mus musculus (mouse): 75686
Entry
75686             CDS       T01002                                 

Gene name
Nudt16, 2310041H06Rik, 2810047L04Rik, 2900006H04Rik, AI851783
Definition
(RefSeq) nudix (nucleoside diphosphate linked moiety X)-type motif 16
  KO
K16855  U8 snoRNA-decapping enzyme [EC:3.6.1.62 3.6.1.64]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu01100  Metabolic pathways
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    75686 (Nudt16)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    75686 (Nudt16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    75686 (Nudt16)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.62  5'-(N7-methylguanosine 5'-triphospho)-[mRNA] hydrolase
     75686 (Nudt16)
    3.6.1.64  inosine diphosphate phosphatase
     75686 (Nudt16)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA degradation factors
   5'-3' decay
    5' exonucleases
     75686 (Nudt16)
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 75686
NCBI-ProteinID: NP_083661
MGI: 1922936
Ensembl: ENSMUSG00000032565
Vega: OTTMUSG00000045306
UniProt: Q6P3D0
Position
9; 9 F1
AA seq 195 aa
MEGHRKVELSEALALGPDWRHACHALLYAPDPRKLFGRIPMRFAVLMQMRFDGRLGFPGG
FVDAQDSCLEDGLNRELREELGEAMSAFRVERSDYRSSHIAARPRVVAHFYAKRLTLEQL
QAVEARAPQAKDHGLEVLGLVRVPLYVLRDGEGGLPAFLENSFIGAAREQLLEALQDLKL
LDPGIIAKLKIPDSK
NT seq 588 nt   +upstreamnt  +downstreamnt
atggaggggcatcggaaagtggagctcagcgaggccctggcgctcgggccggactggcgc
cacgcctgccatgcgctgctctacgcgcccgacccccgcaagctgttcggccgcatcccg
atgcgcttcgccgtgctgatgcagatgcgctttgacgggcgcctgggcttccctggcggc
ttcgtggacgcgcaggacagctgcctggaggacgggctgaaccgggaactgcgcgaggag
ctgggcgaagcgatgtctgccttccgcgttgaacgctctgactaccgcagctcacacatc
gcggccagaccgcgcgtggtggcccacttctatgccaagcgcctgactctggaacagctg
caggctgtggaagccagggcacctcaagccaaggaccatgggctggaggtgctgggcctg
gtgcgggtacccctgtacgtcctccgtgatggtgagggaggcctgcctgcctttctggag
aattccttcattggagctgcccgagagcagctactagaagcccttcaggacttgaaactt
ctggatcctggcattattgcaaaactaaagatcccagattctaagtag

DBGET integrated database retrieval system