KEGG   Mus musculus (mouse): 75687
Entry
75687             CDS       T01002                                 

Gene name
Ripor1, 2310066E14Rik, AI837433, Fam6, Fam65a
Definition
(RefSeq) RHO family interacting cell polarization regulator 1
  KO
K24818  Rho family-interacting cell polarization regulator
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    75687 (Ripor1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  HEAT repeat domain-containing proteins
   75687 (Ripor1)
SSDB
Motif
Pfam: PL48 HEAT_2 HR1
Other DBs
NCBI-GeneID: 75687
NCBI-ProteinID: NP_001074710
MGI: 1922937
Ensembl: ENSMUSG00000038604
Vega: OTTMUSG00000062051
UniProt: Q68FE6
Position
8; 8 D3
AA seq 1223 aa
MMSLSVRPQRRLLSARVSRSQSFAGVLGSHERGPRSFTVFSPPGPPRKPLVLSRVSRMFS
VAHPAPKVPQPERLDLVYTALKRGLTAYLEVHQQEQEKLQRQIKESKRNSRLGFLYDLDK
QVKSIERFLRRLEFHASKIDELYEAYCVQRRLRDGAYNMVRAYSTGSPGSREARDSLAEA
TRGHREYTESMCLLENELEAQLGEFHLRMKGLAGFARLCVGDQYEICMKYGRQRWKLRGR
IESSGKQVWDSEETVFLPLLTEFLSIKVTELKGLANHVVVGSVSCETKDLFAALPQVVAV
DINDLGTIKLSLEVIWSPFDKDDQPSAASTVNKASTVTKRFSTYSQSPPDTPSLREQAFY
NMLRRQEELENGTAWSLSSESSDDSSSPQLSGTARHSTPKPLVQQPEPLPVQVAFRRPES
LTSGSMDEEPAMTPSLVNGHAPYSRTLSHISEASVDAALTEAVEAVDSQSPIPGPSPLVY
PDSTHVERVSSVLPVLNNGHSATSPALSTTGPAPTFIDPAPTTQLDLVHKTTDSAPSELP
SITHTTTSSAYSAVSLVNSVPSLTSTTIGSAHTTTPSPLTSTGSVPNATDSTQATPSPTH
STPSPTHTTIRLTHTTVSPTHSSPSPIHTTPSPTHTTVSPTCTTPSSGHSTTSPTQEAKM
STHTTGAVGPVQTTTSPISTTESPSPSTDVAIISSSSAESTGPGTEPLPCSHPASPPYTK
ADPTASCTSYQSLASSGSKPLTSPAPDSPEQIPKSPSSSPSSSAPEPQHSEHNLAAVAQA
PVPEATGGAGDRRLEEALGTLMSALDDYRGQFPELQGLEQEVTRLESLLMQRQGLTRSRA
SSLSITVEHALESFSFLNDDEDEDNDGPGDRHTSSPEVVAEDRLDSSNGQSLSTGCSALD
ATLVQHLYHCSRLLLKLGTFGPLRCQEAWALERLLREARVFQEVCERSKLWGNSATSAQE
VVQFSASRPGFLTFWDQCTEGLSPFICSVERVLLTFCSQYGARLSLRQPGLAEAVCVKFL
EDALGQKLPRRPQPGPGEQFTIFQFWSYVEALDSPSMDAYVTETAEEVLLVQNLNSDDQA
VVLKALRLAPEGRLRKDGLRALSSLLVHGNNKVMAAVSTQLRSLSLGPVFRERALLCFLD
QLEDGDVQTRVAGCLALGCIKAPEGIEPLVYLCQTDTEAVREAARQSLQQCGEEGQSAHR
QLEESLDALPCIFGPSSMASTAF
NT seq 3672 nt   +upstreamnt  +downstreamnt
atgatgtccctgtcggtgcggccgcagcgccgcctgctcagcgcccgggtcagtaggagc
cagtccttcgcaggcgtcctcggcagccacgagcgcgggcccaggagcttcactgtcttc
agcccaccagggcccccacggaagcccctagtgctctcccgagtgtcaaggatgttttct
gtggcccatccagctcccaaggtgccgcagccagagaggctggacctggtgtacactgct
cttaagcggggactgacggcctacttggaagtgcatcagcaggagcaggagaagctccag
cgccagataaaggagtccaaaaggaattcccgcctaggcttcctgtatgacttggacaag
caagtcaagtccattgaacgctttcttcgacgactggaattccatgccagtaagattgac
gagttgtatgaagcatactgtgtccagcggcgtctcagggatggtgcctacaacatggtc
cgcgcctatagcactgggtccccagggagtcgagaggcccgagacagcctggccgaggcc
actcgaggccatcgagagtatacagagagcatgtgtcttctggagaatgagctggaggca
cagttgggcgagtttcatctccggatgaaagggctggctggcttcgccaggctgtgtgtg
ggcgatcaatatgagatctgcatgaaatatggccgtcagcgctggaagttgcgaggccgg
atagagagtagtggcaagcaggtgtgggacagtgaagagaccgtctttcttcctctactc
acagaattcctgtctatcaaggtgacagaattaaagggactggctaaccacgtagtcgtg
ggcagtgtctcctgtgagaccaaggacctgtttgccgccctgccccaggttgtggctgtg
gatatcaatgatcttggcaccatcaagctaagcctagaagtcatatggagtccctttgac
aaggatgaccagccttcagctgcttctacagtcaacaaagcttccacagtcaccaagcga
ttttccacatatagccagagcccgccagacacaccctcactccgagaacaggccttttat
aacatgttacggcgacaggaggagctcgagaatgggacggcctggtccctgtcctctgaa
tcgtcagatgattcatcaagcccgcagctctctggcacagctcgacactcaactcccaag
cctctggtgcaacagcctgagcccctgcctgtccaagttgccttccgaaggccagagagc
ctcacgtctggttccatggatgaagagccagccatgaccccatccctggtcaatgggcat
gccccttacagccggactctcagccacatcagcgaggccagcgtggatgctgccttgact
gaggccgtggaagctgtggactcacaaagcccaatcccagggcctagcccgcttgtctat
ccagattccacccacgtggagcgtgtcagtagtgttctgcctgtcctcaacaatggccat
tctgccacaagtcccgccctcagtacaactggccccgcccccacatttatagaccctgcc
ccaacgacacagctagacttggttcacaaaaccacagactccgccccttctgagttgccc
agcatcacacatactacgacaagctctgcatatagtgctgtaagccttgtcaacagtgtt
ccaagcctaacttccaccactataggttctgcccacacaaccacgccctctcccctcacc
tccacaggctctgttcccaatgcaacagactcaacccaggctaccccaagccctactcac
agtaccccaagccctacccatactactatacgcctcacccacaccactgtaagccctaca
catagctccccgagccccatacacactaccccgagccccacccataccactgtaagtccc
acctgcactactccaagctccggccacagtaccactagtcccactcaagaagccaagatg
tcaactcataccaccggtgctgtgggcccggtccagaccactacaagtcccatttccaca
actgaaagcccctccccttctacagacgtggctataatctccagctcctctgcagaatcc
accggcccaggcactgaacctctgccctgtagtcacccagcctcccctccctacactaaa
gcagaccccacagcttcctgcacctcttaccagagtcttgcttcctctggttcaaaaccc
ctcacaagccctgccccggattccccagaacaaatccctaagagcccaagttcctctccc
tcatctagtgcccctgaaccccaacattcagaacataacctggccgcagttgctcaagcc
ccagtccctgaggcaacgggaggagctggggacagaaggcttgaagaagctcttgggacc
ctaatgtctgcccttgatgactatcgtggtcagttccctgagctgcagggcctggagcag
gaggtgactcggctggagagtctgctcatgcagagacaaggcctgactcgaagccgggct
tccagtcttagcatcactgtggagcatgccctggagagcttcagcttcctcaatgatgat
gaagatgaagacaacgatggtcccggggacaggcacacaagcagcccagaggttgtggca
gaggacagactagactcatcaaatggccagtctctaagcacagggtgttcagccctggat
gctaccttggtccagcacctgtaccactgcagccgcctcctgctgaaactgggcacattt
ggacccctgcgctgccaggaggcctgggccctggaacggctgctgcgggaagcgcgtgta
ttccaggaagtgtgtgaacgcagcaagctatgggggaactctgccacatctgcccaggaa
gtggtacagttctccgcctctcggcccggcttcctgaccttttgggaccagtgtacagag
ggactcagccccttcatctgctctgtggagcgggtgctcctcaccttctgcagccagtac
ggtgcccgtctttccctgcgccagccaggcttagccgaggctgtgtgtgtgaagttcctg
gaagatgccctgggacagaagctgcccaggaggccccaaccaggcccgggggagcagttc
accatcttccaattctggagttatgtagaagccttggacagcccctccatggatgcctat
gtgacagagactgcagaggaggtgttactagtacagaacctgaactctgatgaccaggcc
gttgtgctgaaagccctaaggttagcaccggaggggcgcctgcgaaaggatgggcttcgg
gctcttagctccctgctggtccacggcaacaacaaagtcatggctgctgtcagcactcag
cttcggagcctgtcacttggtcctgtcttccgggaaagggctctcttgtgcttcctggac
cagctggaagatggggacgtgcagactcgagtggccggatgcctggctttgggctgtatc
aaggctcctgagggcattgagcccctggtgtacttgtgccaaacagacacagaagctgtg
agggaagccgcccggcagagcctgcagcagtgcggggaggaaggacagtctgctcatcga
cagctagaggagtccctggatgctctgccctgcatctttgggcccagcagcatggccagc
acagcattctga

DBGET integrated database retrieval system