KEGG   Mus musculus (house mouse): 75695
Entry
75695             CDS       T01002                                 
Symbol
Rilpl1, 2900002H16Rik, 6330559I19Rik, GOSPEL
Name
(RefSeq) Rab interacting lysosomal protein-like 1
  KO
K20173  RILP-like protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    75695 (Rilpl1)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    75695 (Rilpl1)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    75695 (Rilpl1)
Cilium and associated proteins [BR:mmu03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   75695 (Rilpl1)
SSDB
Motif
Pfam: Jnk-SapK_ap_N RILP sCache_like DUF6778 DUF4407
Other DBs
NCBI-GeneID: 75695
NCBI-ProteinID: NP_067405
MGI: 1922945
Ensembl: ENSMUSG00000029392
UniProt: Q9JJC6
Position
5:complement(124631143..124669684)
AA seq 406 aa
MEEPLGSPPAALSALEKNVAELTVMDVYDIASLVGHEFERVIDQHGCESIARLMPKVVRV
LEILEVLVSRHHVAPELDELRLELDRLRVERMDRIEKERKHQKELELVEDVWRGEAQDLL
SQIAQLQEENKQLMTNLNHKDVGFSEEEFQKQEGMSERERQVMKRLKEVVDKQRDELRAK
DRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEM
GSLRAELGKLRERLQGEHSQNGEEEEAEIQPQPDGEESISDAEKAALDLKDPNRPRFTLQ
ELRDVLHERNELKSKVFLLQEELAYYKSEEIEEENRIPQPPPITHPRTSPQPESGIKRLF
SFFSRDKKRLANTQRPTHIHESFGQWAITQRDDGYTEQGQEALQHL
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggaggagccgctagggtcaccgcccgccgccctgtcggctctggagaagaacgtggcg
gagctgaccgtcatggatgtgtacgatatcgcgtcgctcgtgggccacgagttcgagagg
gtcatcgaccaacacggctgcgagtccatcgcacgcctcatgcccaaggtcgtgagggtc
ctggagatcctcgaggtgctggttagccggcaccacgtcgctcccgagctagacgagctg
cgcctggaactggaccggttgcgcgtagagaggatggaccgcattgaaaaggagcgcaag
catcaaaaggagctggagctggtggaggacgtgtggcggggtgaagcacaggacctcctg
tcccagattgcccagctgcaggaggagaataagcagctgatgaccaacctcaaccacaag
gacgtgggcttctccgaggaggagttccagaagcaggaaggcatgtcagagcgtgagcgg
caggtgatgaagaggctgaaggaggtggtggacaagcagagggatgagctccgagccaaa
gacagggagctgggcctgaagaatgaggacgtcgaggctttgcagcagcagcagacgagg
ctaatgaagatcaaccatgaccttcggcaccgggtcaccgtggttgaggcccaggggaaa
gccctgattgagcagaaggtggagctcgaagcagacctgcagaccaaggagcaggagatg
ggcagcctgcgggctgaactcggaaagcttcgcgagaggctgcagggcgagcacagccag
aatggggaggaggaggaggctgagatccagccgcagccagatggagaggaatcgatttca
gatgcagagaaggccgccctggacctcaaggaccccaaccgcccgaggttcacgctccag
gagctgcgggacgtcctgcacgagaggaacgagctcaagtccaaggtgtttctgctgcaa
gaggaactggcctactataagagtgaagaaatagaagaagagaatcgaataccccagcct
ccgcccattacacacccgaggacgtccccccagcctgaatcggggatcaagcgactgttt
agctttttctcccgggacaagaagcgcctggccaacacgcagagacccacacacatccac
gagtcctttggccagtgggcaattacccagcgagatgacgggtacacagagcaaggacag
gaagccctgcagcacctgtga

DBGET integrated database retrieval system