KEGG   Mus musculus (mouse): 75705
Entry
75705             CDS       T01002                                 

Gene name
Eif4b, 2310046H11Rik, AL024095, C85189, Eif4a2
Definition
(RefSeq) eukaryotic translation initiation factor 4B
  KO
K03258  translation initiation factor 4B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    75705 (Eif4b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    75705 (Eif4b)
   04150 mTOR signaling pathway
    75705 (Eif4b)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    75705 (Eif4b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    75705 (Eif4b)
   03012 Translation factors [BR:mmu03012]
    75705 (Eif4b)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     75705 (Eif4b)
   mRNA cycle factors
    Stress granule specific factors
     75705 (Eif4b)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    75705 (Eif4b)
SSDB
Motif
Pfam: RRM_1 RRM_7
Other DBs
NCBI-GeneID: 75705
NCBI-ProteinID: NP_663600
MGI: 95304
Ensembl: ENSMUSG00000058655
UniProt: Q8BGD9
Position
15; 15 F2
AA seq 611 aa
MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVPKPVSWADETDDLEGDVSTTWHSNDD
DVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEDSIKDFFRGLN
ISAVRLPREPSNPDRLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRD
DRSFGRDRNRDSDKTDTDWRARPTTDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDG
YRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYED
RYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPRLNLKPRSAPKEDDASASTSQSSRAASI
FGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLDRRPRERHPSWRSEETQERERSRT
GSESSQTGASATSGRNTRRRESEKSLENETLNKEEDCHSPTSKPPKPDQPLKVMPAPPPK
ENAWVKRSSNPPARSQSSDTEQPSPTSGGGKVAAVQPPEEGPSRKDGNKVDVVGATQGQA
GSCSRGPGDGGSRDHWKDLDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSVDG
EDEDEGDDCTE
NT seq 1836 nt   +upstreamnt  +downstreamnt
atggcggcctcagcaaaaaagaagaataagaaggggaagaccatctccctaacggacttt
ctagctgaggatggaggaactggtggaggaagcacctatgtccccaaaccagtcagctgg
gctgatgaaacagacgatctggaaggagatgtgtcaacaacttggcatagtaacgatgat
gacgtgtacagggcgcctccaattgaccgttccatccttcccactgctccacgggctgct
cgggaacccaatattgaccggagccgtcttcccaagtcgccaccctacactgctttccta
gggaatctgccctatgatgtgacagaagactccattaaggatttctttagaggattaaat
atcagcgctgtacgcttaccacgggaacccagcaatccagacaggttgaaaggtttcggc
tacgcagaatttgaggacctggattctctgctcagtgctctgagtctcaatgaagagtct
ctaggtaacaggagaattcgtgtggatgttgctgatcaagcacaggataaagacagggat
gaccgttcttttggtcgagatagaaatcgggattctgacaaaacagacacagactggagg
gcccgtcccaccacagacagttttgatgactacccacctagaagaggcgatgatagcttt
ggagacaagtatcgagatcgttacgattcagaccggtatcgggatgggtatagggacgga
tatcgggacggcccacgcagagacatggaccgctatgggggccgggatcgctatgatgac
cgaggcagcagagactatgaccgaggctatgactccaggataggcagtggcagaagggca
tttggaagtgggtaccggagagatgatgactacagaggaggtggggaccgctatgaagac
cgctatgacagacgggatgatcggtcgtggagctccagggatgactactctcgggatgat
tataggcgtgatgacagaggtcccccccagagacccagactgaacctcaagcctcgaagc
gctcctaaggaggatgacgcctccgccagcacctcccagtccagccgggcagcctccatc
tttggaggggcgaagcctgttgacacagctgctagggaaagagaagtagaggagcggcta
cagaaggagcaggagaagctgcagcgtcagctggatgagccaaaactagaccgccggccc
cgggagagacacccaagctggcgaagtgaagaaactcaggaaagagaacggtcaaggaca
ggaagtgagtcatcgcagactggggcctcagccacatctggcagaaatacacgaaggaga
gagagtgagaagtctctagaaaatgaaaccctcaataaagaagaagactgtcactctcca
acctctaagcctcctaaacctgaccagcctctaaaggtaatgccagcccctccaccaaag
gagaatgcgtgggtgaagcgaagctctaaccctcctgcccgatctcagagctcagacaca
gagcagccgtcccctacaagtggtggagggaaagtagctgcagtccagccccctgaggaa
ggaccatcaagaaaagatggaaataaagtggatgtggtgggtgccacacaaggccaagct
ggaagctgcagccgtggtcccggggatggagggagcagagaccactggaaggacttggat
aggaaggatggcaaaaaagatcaagactccagatctgcgcctgagccaaagaaacctgag
gagaacccagcctctaagttcagctctgcaagcaagtacgctgctctgtctgtggatggc
gaggatgaggatgagggcgacgactgcactgagtag

DBGET integrated database retrieval system