KEGG   Mus musculus (mouse): 75712
Entry
75712             CDS       T01002                                 

Gene name
Tmem14a, 5730496E24Rik, C85783, PTD01, PTD011
Definition
(RefSeq) transmembrane protein 14A
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Tmemb_14
Other DBs
NCBI-GeneID: 75712
NCBI-ProteinID: NP_083674
MGI: 1922962
Ensembl: ENSMUSG00000025933
Vega: OTTMUSG00000029833
UniProt: P56983
Position
1; 1 A4
AA seq 99 aa
MDLIGFGYAALVTIGSVLGYKRRGGVPSLIAGLSVGLLAGYGAYRVSNDRRDVKVSLFTA
FFLATIMGVRFKRSKKVMPAGLVAGLSLMMILRLVLLLL
NT seq 300 nt   +upstreamnt  +downstreamnt
atggacctgattggttttggttatgcagcccttgtgacaattgggagtgttttgggatat
aagcgaagaggtggagttccatctctgattgctgggctttctgttggacttttggctggc
tacggagcctaccgtgtctccaatgacagacgggatgtcaaagtgtcattgtttacagct
ttcttcctggccaccataatgggtgtgagatttaagaggtccaagaaagtaatgcctgct
ggtctagttgcaggcttaagcctcatgatgatcctgagacttgtgctgctgctgctgtag

DBGET integrated database retrieval system