KEGG   Mus musculus (mouse): 75717
Entry
75717             CDS       T01002                                 

Gene name
Cul5, 4921514I20Rik, 8430423K24Rik, AI852817, C030032G03Rik, C330021I08Rik, VACM, VACM-1, VACM1
Definition
(RefSeq) cullin 5
  KO
K10612  cullin 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    75717 (Cul5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    75717 (Cul5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    75717 (Cul5)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    75717 (Cul5)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Cullin
     75717 (Cul5)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     75717 (Cul5)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 Stork_head
Other DBs
NCBI-GeneID: 75717
NCBI-ProteinID: NP_082083
MGI: 1922967
Ensembl: ENSMUSG00000032030
Vega: OTTMUSG00000030717
UniProt: Q9D5V5 Q2M4H5 G3X914
Structure
PDB: 
2WZK

Position
9; 9 A5.3
AA seq 780 aa
MATSNLLKNKGSLQFEDKWDFMHPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGSSK
IHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEVTLLG
KQSSNKKSNMEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGV
RESYVNLCSNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKE
EEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLM
DKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQ
DDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTP
LSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWL
REVGMPADYVNKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSS
EKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQL
AVLFAWNQRPREKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLLYDPQVNSPKDF
TEGTLFSVNQDFSLIKNAKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQEAII
QIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQMEWLIEHRYIRRDEADINTFIYMA
NT seq 2343 nt   +upstreamnt  +downstreamnt
atggcgacgtctaatctgttaaagaataaaggttctctccagtttgaagacaagtgggac
ttcatgcatccaattgttttgaagcttttacgccaggaatctgtaacaaaacagcagtgg
tttgatctattttcggatgtacatgctgtctgtctctgggatgataaaggctcatcaaaa
attcatcaggctttaaaagaagatattcttgagtttattaagcaagcacaggctcgtgta
ctgagccatcaagatgacacagctttgctgaaggcatatattgttgaatggcggaaattc
ttcacacagtgtgatattttaccaaaacctttttgtcaattagaggtgactctattgggt
aaacaaagcagcaataaaaaatcaaatatggaagacagtattgttcgaaagctcatgctt
gatacgtggaatgagtcgattttttcaaatataaagaacagactccaggacagtgcaatg
aagctggtgcatgctgagagattaggggaagcttttgattcccagctggtcatcggggtg
cgagagtcctatgttaatctttgctccaaccccgaggacaagcttcagatctatagggat
aattttgagaaggcatacttggactcaacagagaggttttatagaacacaggcaccctca
tatttacagcaaaatggtgtgcagaattacatgaaatatgcagatgctaaattaaaagaa
gaagaaaaaagagcactccgatacttagaaacacgacgagagtgtaactctgtggaagca
ctcatggaatgctgtgtaaatgcgctggtgacctcctttaaagagactattttagcagaa
tgccaaggcatgatcaagcgaaatgaaactgaaaagttacatttgatgttttccttgatg
gacaaagttcctaatgggatagagccgatgttgaaggacttggaggagcatattataagt
gcgggcctagcagacatggtggccgcagctgaaaccatcactactgactctgagaagtat
gtggagcaattacttacactgtttaatagattcagtaaactggtcaaagaagcttttcag
gatgatcctcgtttccttactgcaagagataaggcatataaagcagttgttaatgatgct
actatatttaaacttgaattgcctttgaagcaaaaaggagtggggttgaaaactcagcct
gagtcaaaatgccccgagttgcttgccaattactgtgacatgttgttaaggaaaacgcca
ttaagcaaaaaactaacatctgaggagattgaagcaaagcttaaagaagtgctcttggta
cttaaatatgtacaaaacaaagatgtttttatgaggtatcacaaagctcatcttacccga
cgtctcatattggacatctctgctgatagtgagattgaagaaaacatggtagagtggcta
agagaagttggtatgccagcagattatgtgaacaagcttgctagaatgtttcaggacata
aaagtatctgaagacttgaaccaagcttttaaggaaatgcacaaaaataataagttggca
ttaccagctgattccgttaatataaagattttgaatgctggtgcttggtctagaagctcc
gagaaagtctttgtctcacttcctactgaactggaggatttgatacctgaagtagaagaa
ttttacaaaaaaaatcacagtggtagaaaattacactggcaccatctcatgtcaaatgga
attataacatttaaaaatgaagtaggtcagtatgatttggaagtaaccacgtttcagttg
gctgtgttgtttgcatggaaccaaaggcctagagagaaaatcagctttgaaaatctaaaa
cttgcaacggaactcccagatgctgaacttagaaggactttatggtctttagtagctttt
cccaagctcaaacggcaagttttgttgtatgaccctcaagtcaactcacccaaagatttt
acagaaggcaccctcttctcagtgaaccaggacttcagtctcataaaaaatgcaaaagta
cagaaaagggggaaaatcaatttgattggacgcttgcagctcactacagaacgaatgaga
gaagaagaaaatgaagggatagtccaactaagaatattaagaacccaggaagccatcata
caaataatgaaaatgagaaagaaaattagcaatgcccagctgcagactgaattagtagaa
attctgaaaaacatgttcctgcctcagaagaagatgataaaggagcagatggagtggctg
attgaacacaggtacatccggagggacgaggccgacatcaacaccttcatctacatggcc
tag

DBGET integrated database retrieval system