KEGG   Mus musculus (house mouse): 75718
Entry
75718             CDS       T01002                                 
Symbol
Vwa5b1, 4931403E03Rik
Name
(RefSeq) von Willebrand factor A domain containing 5B1
  KO
K24510  von Willebrand factor A domain-containing protein 5
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    75718 (Vwa5b1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Von Willebrand domain-containing proteins
  VWA domain-containing proteins
   75718 (Vwa5b1)
SSDB
Motif
Pfam: VWA_3 VIT_2 VWA VWA_2 VIT VWA_CoxE
Other DBs
NCBI-GeneID: 75718
NCBI-ProteinID: NP_083677
MGI: 1922968
Ensembl: ENSMUSG00000028753
UniProt: A9Z1V5 B1AZ81
Position
4:complement(138291540..138363303)
AA seq 1215 aa
MPGLLNCLTGAALPLMESDVTSYVSGYALGLTASLTYGNLEAQPFQGLFVYPIDEYSTVV
GFEAVIADRVVTIQLRDKAKLDRSHLDIQPATVTGNFPEEESPIAPGKVTLDEDLERVLF
VVNLGTIAPMENVTVFISTSSELPTLPSGAVRVLLPAICAPTVPPSCTHRFGSSSPQPQG
KDPHCFGTQTKDSYNRLCLATLLDTKVTNPMEYEFKFQLEIRGPCLLAGVESPTHEIRAD
AAPSAHSAKSIIITLAKKHTFDRPVEILLHPSEPHMPHVLVEKGDMTLGEYDQHLKGKAD
FIRGTKKDNSAERKTEVIRKRLHKDIPHHSVIMLNFCPDLQSVQPNPRKAHGEFIFLIDR
SNSMSKTNIQCIKEAMLVALKSLMPACFFNIIGFGSTFKAVFASSRIYNEENLTMACDCI
QRMQADMGGTNMLSPLKWVLRQPLRRGHPRLLFLITDGSVNNTGKVLELVRNHASSTRCY
SFGIGPTVCYRLVKGLASVSKGSAEFLMEGERLQPKMVKSLKKAMAPVLSDVTVEWVFPE
TTEALISPVSTSSLFPGERLMGYGIVCDASLYISNSRSDKRRKYGMLHTQESSSSVFYPS
QDEGLSPGSGNCAKNVNQGQTKDAHPCNGDSPTHHGLDVSRRRRAYSTNQISSHKTCPRA
TTASDPTGTARRYPLRKAKVQDLASESDWESQKWQTDLQTLLNEGHNLSQGPKLHGPGAR
RPSLLPQGCQLMRFFDQKPQAWGPVRELDCGASRTSAPNSQSSEDLAIEPAHCPSTFERE
TSLDLEPMAESEEQANPCRTATPSPVVGKALVKGLCANQRMQWEVSFELEPPALKRGDTQ
NADMWSETFHHLAARAIIREFEHLAEREDEIELGSNRRYQVNAVHTSKACSVISKYTAFV
PVDINKRQYLPTVVKYPNSGAMLSFRNLTRQWGGSSAGLGRPQSMLREHSSAAGDSKFQT
LALQDSPTSTFNKTPSPGHEKQTTAEGPPQNLSASAPSSMKATETLFGSKLNLNKSRLLT
RATKGFLSKSLPKASEATPGSQSSDYIPLVSLQLASGAFLLNEAFCTTIQIPMEKLKWTS
PFSCLRMSLVTRRQDLKTQSPQDCTSLSSSPPSCDGISLKSEESSDQESNAMLEHMGKLW
ATVVALAWLEHSSANYIIEWELVAAKASSWVEKQKVPEGRTLSTLKNTARQLFVLLRHWD
EKLEFNMLCYNPNYV
NT seq 3648 nt   +upstreamnt  +downstreamnt
atgcctggcctgctgaactgcctcacaggggcagccctgcctctcatggaatccgatgtc
acctcctatgtcagtggctatgccctgggcctgacagcctccctcacctacggcaacctg
gaggcccagccctttcaaggtctcttcgtgtatccaatagacgagtatagcacagtggtt
ggctttgaagcagtcattgctgaccgtgttgtgaccatacagctcagagacaaagccaag
ctggacagaagccacttggatatccaacccgccactgtcacagggaactttccggaagag
gagagtcccatcgcaccaggaaaggtgaccttggatgaggatctggagcgggttctgttc
gtggtcaacctggggaccattgcccccatggagaatgtcaccgtcttcatcagcacctcc
tccgaactccccacactgcccagcggggctgtgagggttcttctgccggccatctgcgcc
ccgaccgtgcctccatcctgtacccacaggtttggctcctccagcccacagccacaaggc
aaagacccacactgcttcggcacccagaccaaggactcctataacaggctgtgtctggcc
actctcctggacacaaaggtgaccaacccaatggaatatgaattcaaatttcagctggaa
atccgtgggccctgtctgctcgcaggggtggagagtcccactcatgaaatccgagcagac
gcagccccatcggcacactccgccaagagcatcatcatcacgttggccaaaaaacatacc
tttgaccggccagtggagattcttctccaccctagcgagcctcacatgccacacgtcctg
gtggagaaaggggacatgaccctgggggaatatgaccagcacttgaagggaaaagcagat
ttcattcgggggacaaagaaggacaacagcgcggagcggaagacagaagtcatccggaag
cgtctccacaaagacattccccaccactcagtcatcatgctcaacttctgtcctgacctc
cagtctgtgcagcccaacccgaggaaagcccacggggagtttatcttcctcattgatagg
agtaacagcatgagcaagaccaacatccagtgcatcaaggaggccatgctggtggccctc
aagagcctcatgccagcgtgcttcttcaacatcattggttttggatccacatttaaggca
gtctttgcttccagtcggatctacaatgaggagaacttgaccatggcatgtgactgcatc
cagagaatgcaggctgatatgggaggcaccaacatgctctcccccctcaagtgggtcctg
cggcagccactgcgccggggtcacccacggctcctcttcctgatcacggatgggtccgtg
aacaacacagggaaggttctggagctggtacggaatcacgcctcttctaccaggtgctat
agctttggaattggacccacggtctgctaccgactggtcaaagggctggcatctgtatcc
aagggcagcgcagagttcctgatggagggggaacggctgcaaccaaagatggtcaaatcc
ttgaagaaggccatggcgccagtgctgagtgacgtgactgtggagtgggtctttcccgag
accacggaggccctgatctctcctgtcagcaccagctcccttttccctggggaacggctg
atgggatatggcattgtgtgtgatgcctccttgtacatttccaattccagatctgacaaa
aggcgaaagtatggcatgctgcacactcaggagtccagcagctccgtcttctacccctca
caggacgagggactcagcccaggcagtggaaactgtgccaagaacgtcaaccaggggcag
accaaagatgcccatccatgcaatggagactcccccacccatcacggtctggatgtctcc
cggcggcggagagcatacagcactaaccagatctccagccacaagacttgcccaagggct
accacagccagcgaccccaccgggactgccaggagatacccactgcgaaaagccaaggtg
caagaccttgccagtgagagcgactgggagagccagaagtggcagactgatctgcagacc
ctacttaacgaaggccataacctgagccagggccccaaacttcatggcccaggagcccgc
aggccttccctactgcctcaaggctgccagctcatgcgcttctttgaccagaagccccag
gcctggggccctgtgagagagctggattgtggtgccagccggacgtctgcccctaacagc
caaagctctgaagatctggccatagagccagcccattgtccttcaacctttgaacgggag
acatccttagacttggagcccatggctgagtccgaggagcaagccaatccctgcaggact
gccactccaagccctgtggtgggcaaggctttggtcaaaggcctgtgcgccaaccaacgc
atgcagtgggaagtgagcttcgagctggagcctccagccctgaagaggggggacacacag
aacgctgacatgtggagtgagactttccaccacctggcggcccgcgccatcatccgagaa
ttcgagcatctggcagagcgcgaggacgagatcgagctggggtccaatcgccgataccag
gtgaacgccgtgcacaccagcaaggcctgcagcgtgatcagcaaatacacggcctttgtg
cctgtggacataaacaagaggcagtacctgcccacggtcgtcaagtaccccaactctggt
gccatgctcagcttccggaacctgactcgacagtgggggggctcttcggctggcctggga
aggccccagtctatgctcagagaacactcctcagccgcaggagacagcaaattccagact
ctagccctacaagacagccctacttcaaccttcaataaaaccccatcccccggccatgag
aagcaaaccacggcagaaggtccccctcaaaacctgtccgccagcgctccatcctccatg
aaggccactgagactctctttggatctaagttgaatctcaacaaatccaggctgctgacc
cgagctaccaaaggctttctcagcaaatcgttgcccaaggcttcagaggcaaccccaggc
agccagagctctgactacataccactggtgtctctgcagctggcctcgggagcctttttg
ctcaatgaagccttctgcacgaccatccaaatccccatggagaaactcaagtggacctca
cccttctcctgcctccgaatgtccctcgtcacccgccgacaggatctgaagacccagagt
ccacaggactgcaccagtctctcctcttcacccccatcctgtgacggcatctccctaaag
tctgaagagagctcagaccaggagtccaatgcaatgctggagcacatgggaaagctgtgg
gccacggtggtggcgctggcgtggctggaacacagctcagctaactacatcattgagtgg
gagctggtggctgccaaggccagctcctgggtggagaagcagaaagttcctgagggccgc
accttgagcactctcaagaacactgctcgccaactctttgtgcttctgcgacactgggat
gagaaattagagttcaatatgctctgttacaaccccaattatgtgtaa

DBGET integrated database retrieval system