KEGG   Mus musculus (mouse): 75723
Entry
75723             CDS       T01002                                 

Gene name
Amotl1, 2310010G08Rik, 2310067L22Rik, 4932416D09Rik, JE, JEAP, mFLJ00155
Definition
(RefSeq) angiomotin-like 1
  KO
K06104  angiomotin like
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04530  Tight junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    75723 (Amotl1)
SSDB
Motif
Pfam: Angiomotin_C
Other DBs
NCBI-GeneID: 75723
NCBI-ProteinID: NP_001074864
MGI: 1922973
Ensembl: ENSMUSG00000013076
Vega: OTTMUSG00000034188
UniProt: Q9D4H4
Position
9; 9 A2
AA seq 968 aa
MRRAKSRRGPCEPVLRAPPPICYSPSSPVQILEDPAYFYPDLQLYSGRHEASTLTVEASG
GLRGKSVEDPLSSFHSPNFLRTPEVEMRGSEDVASGRVLQRLIQEQLRYGTPTENMNLLA
IQHQATGSAGPAHATTNFSSTETLTQEDPQMVYQSARQEPQGQEHQGDNTVMEKQVRSTQ
PQQNNEELPTYEEAKAQSQFFRGQQQQQQQQQQQQQQQQQQGQGPLSHTYYMAGGTSQKS
RTEGRPTVNRANSGQAHKDEALKELKQGHVRSLSERIMQLSLERNGAKQHLPSSGNGKSF
KAGGEPSPAQPVCKALDPRGPPPEYPFKTKPMKSPVSKNQDHGLYYNDQHPGVLHEMVKP
YPAPQPARTEVAVLRYQPPPEYGVTSRPCQLPFPSTVQQHSPMSSQTSSIGGTLHSVSLP
LPLPISLAASQPLPASPNQQLGPDAFAIVERAQQMVEILTEENRVLHQELQGCYDNADKL
HKFEKELQSISEAYESLVKSTTKRESLDKAMRTKLEGEIRRLHDFNRDLRDRLETANRQL
SSREYDGHEDKAAESHYVSQNKEFLKEKEKLEMELAAVRTASEDHRRHIEILDQALSNAQ
ARVIKLEEELREKQAYVEKVEKLQQALTQLQSACEKRGQMERRLRTWLERELDALRTQQK
HGTGPPVSLPECNAPALMELVREKEERILALEADMTKWEQKYLEESTIRHFAMSAAAAAT
AERDTTISNHSRNGSYGESSLEAHIWPEEEEVVQANRRCQDMEYTIKNLHAKIIEKDAMI
KVLQQRSRKDAGKTDSASLRPARSVPSIAAATGTHSRQTSLTSSQLTEEKKEEKTTWKGS
IGFLLGKEHQGQASAPLLPTTPASALSLPASTTSASSTHAKTGSKDSSTQTDKSTELFWP
SMASLPSRGRLSTAPSNSPILKHPAAKGAVEKQENSPGHGKASEHRGRVSNLLHKPEFPD
GEMMEVLI
NT seq 2907 nt   +upstreamnt  +downstreamnt
atgcggagggcaaagtcgcgccggggaccttgcgagcctgtgcttagagctcctcctccc
atctgctacagccccagcagtcctgtgcagattctagaagaccccgcctacttctaccca
gacttgcagctctattctgggaggcatgaagcatctactttgacagtggaggcaagtgga
ggcctaagggggaaaagcgtagaggaccctctctccagcttccactccccgaacttcctg
aggacgcccgaggtggaaatgagaggttctgaggatgtagcctctggaagagtgttacag
cggctgatccaggaacaactgcgctatggcaccccaactgagaacatgaacctgctggcc
attcagcaccaggccacagggagtgcagggccagcccacgccaccaccaacttttcttcc
acggaaaccctcactcaagaagatccacaaatggtctatcagtcggcccgccaagaaccg
cagggtcaagagcatcagggagacaatacggtgatggagaagcaggtccggtccacacag
cctcagcagaacaacgaggagctccccacgtatgaggaagccaaggcccagtcccagttc
ttcaggggacagcagcagcagcagcaacagcagcagcagcaacagcagcagcaacagcag
cagggacaggggccccttagccacacttattacatggccggaggtaccagtcagaagtcc
cgcactgaggggaggcccacagtgaaccgggccaacagtggacaggcgcataaggatgag
gccctgaaagaactaaagcagggccatgtccggtccctcagtgagaggatcatgcagctg
tcactggagaggaatggggctaagcaacacctccccagctctggaaatggaaagagcttc
aaagctggaggagagccatccccagctcagcctgtctgtaaagcactggaccctcgtggc
cctccacctgaataccccttcaagaccaagccaatgaaatccccagtcagcaagaaccaa
gatcacggtctttactacaatgaccagcaccctggggtactccatgagatggtcaaacct
tacccagcacctcagcctgcgagaacagaagtggccgtcctgaggtatcagccacccccg
gagtatggcgtcaccagccggccctgccagctgccttttccatctacggtgcagcagcat
agccccatgtcctctcagacctcctccatcggtggtactctgcactccgtctccctgcct
cttccacttcccataagcctggcggcttcacagcccctaccagcctcccccaaccagcag
cttggaccggatgcctttgcgattgtggagcgagcccagcaaatggtagagatcctgaca
gaggagaaccgtgtgcttcaccaggagcttcagggctgctatgacaacgctgacaagctc
cacaagtttgaaaaagagctgcagagtatttcggaggcctacgagagcctggtcaagtcc
accaccaagcgtgagtctctggacaaggcaatgagaaccaagctcgaaggcgagataagg
agacttcatgacttcaacagagatctccgagatcgactggagacagccaacaggcagctg
tccagcagggaatacgatgggcatgaagacaaagctgcagagagccattacgtgtcccag
aacaaagaattcttgaaggaaaaggaaaagttggaaatggagttggcagcagtgcgtacg
gcaagtgaggaccatcggaggcacatcgagatcctggaccaggctttgagcaatgcgcag
gctagagtgatcaaactggaggaagagttacgagagaagcaagcctatgtggaaaaggtg
gagaagctgcagcaggccctgacccagctgcagtcagcgtgcgagaagcgagggcagatg
gaacgcaggttgcggacctggctggagagggagctagacgctctgaggacacagcagaaa
catggcacaggccctccagtcagtctcccagaatgtaatgctcctgccctcatggagctg
gtgagggagaaggaggagcggatcctcgccttggaggccgacatgaccaagtgggagcag
aagtacctggaagagagcaccatccggcactttgccatgagcgcagctgccgctgccaca
gccgagagggacaccaccatcagcaaccactcgaggaatggcagctatggggagagctcc
ctggaggcccacatctggccagaggaagaagaagtggtgcaggccaacaggaggtgtcag
gacatggagtacactattaaaaacctccatgccaaaatcatagagaaggatgccatgata
aaggtcctgcagcagcgatcccgtaaggatgctgggaagacggactctgccagcctgagg
cctgcccgctctgtcccatccatcgctgcggccactgggacacattctcgccagacttct
cttaccagcagccagctgacagaagagaaaaaggaagagaagacgacctggaaagggagt
ataggattcctgctgggaaaggaacaccagggacaggcatctgcccctctgctgccgacc
acacctgcctctgcattgtcccttccggcctctaccacatcggccagcagcacccacgcc
aagacgggcagcaaggacagcagcacacagaccgacaagagcacggagctcttctggccc
agcatggcttccctccccagccgtggcaggctgagcacagccccttccaacagccccatc
ctaaagcatccagctgccaaaggagccgtggagaagcaggagaactctcctggtcatggg
aaggcatcggagcacagaggccgagtcagcaacttgctgcacaagcctgagttcccagat
ggcgagatgatggaagtgctcatctag

DBGET integrated database retrieval system