KEGG   Mus musculus (mouse): 75725
Entry
75725             CDS       T01002                                 

Symbol
Phf14, 1110001C23Rik, 4932409F11Rik, 5730446A07Rik, AA623952, AV297001, mKIAA0783
Name
(RefSeq) PHD finger protein 14
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-HC5HC2H_2 PHD zf-HC5HC2H PHD_2 Prok-RING_1 C1_1
Other DBs
NCBI-GeneID: 75725
NCBI-ProteinID: NP_083680
MGI: 1923539
Ensembl: ENSMUSG00000029629
Vega: OTTMUSG00000017311
UniProt: Q9D4H9 G5E8S0
Position
6; 6 A1
AA seq 881 aa
MDRSSKRRQVKPLAASLLEALDYDSSDDSDFKVGDASDSEGSGNGSEDPSKDSGEGSCSD
SEENILEEELNEDIQVKEEQLKNSTEEIMPSDKQLIKMEKKEEEENGERPRKKKEKEKEK
EKEREKDKEKATVSDSAAASAAGTTPATSPPAVTSPSVPTTTTTTTEEQVSEPKKWNLRR
NRPLLDFVSMEELNAMDDYDSEDDNDWRPTVVKRKGRSASQKEGSDGDNEDDDDEGSGSE
EDENDEGNDEDHSSPASEAGGKKKRSKVLSRNSADDEELTNDSLTLSQSKSNEDSLILEK
SQNWSSQKMDHILICCVCLGDNSEDADEIIQCDNCGITVHEGCYGVDGESDSIMSSASEN
STEPWFCDACKCGVSPSCELCPNQDGIFKETDAGRWVHIVCALYVPGVAFGDIDKLRPVT
LTEMNYSKYGAKECSFCEDPRFARTGVCISCDAGMCRAYFHVTCAQKEGLLSEAAAEEDI
ADPFFAYCKQHADRLDRKWKRKNYLALQSYCKMSLQEREKQLSPEAQARINARLQQYRAK
AELARSTRPQAWVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDNSDTSSSVDGR
RKHKQPALTADFVNYYFERNMRMIQIQENMAEQKNIKDKLENEQEKLHVEYNKLCESLEE
LQNLNGKLRSEGQGIWALLGRITGQKLNVPAILRAPKERKPSKKEGGTQKTSALPTVLYS
CGICKKNHDQHLLLLCDTCKLHYHLGCLDPPLTRMPRKTKNSYWQCSECDQAGSSDMEAE
MAMETLPDGTKRSRRQIKEPVKFVPQDVPPEPKKIPIRNTRTRGRKRSFVPEEEKHEERV
PRERRQRQSVLQKKPKAEDLRTECSTCKGTGDNENLVRNLS
NT seq 2646 nt   +upstreamnt  +downstreamnt
atggatcgcagctccaagaggaggcaggtgaagcctttggccgcttctctcctggaagct
cttgattatgatagttcagatgacagtgattttaaagttggagatgcttcagattctgaa
gggagtggtaatggaagtgaagatccttcaaaggacagtggagaaggttcctgtagtgat
tctgaggaaaacattttagaagaagaactgaatgaagatattcaagtaaaagaagaacag
cttaaaaattctacagaggaaataatgccatcagacaaacagttaattaaaatggaaaag
aaggaagaagaagaaaacggagaaagacctagaaagaaaaaggagaaagaaaaggagaaa
gaaaaggaaagggagaaggacaaagagaaagcaacagtatctgatagtgcagctgcttct
gctgctggcaccacaccagccacaagccctcctgctgtcacctccccttctgtccctacc
accactaccaccaccacggaggaacaagtcagtgagcccaagaaatggaatcttcgtcgg
aaccgtcccctgttggactttgtatccatggaagaactcaatgctatggatgattatgac
agtgaggatgataatgactggagacctactgtagtaaagagaaaggggcgatcagcgtct
cagaaggagggcagtgatggagacaatgaggatgatgacgatgagggaagtgggagtgag
gaagatgagaatgatgagggcaatgatgaagatcatagcagccctgctagcgaagcaggt
ggcaagaagaagaggagtaaagttcttagcagaaacagtgctgatgatgaggaactgacc
aatgatagcctgaccctatctcaaagcaagagtaatgaggactctctgattcttgagaag
agtcaaaattggagttctcagaaaatggaccacattctgatttgctgtgtttgtcttgga
gataatagtgaagatgcagatgaaataattcagtgtgataattgtggcattacagttcat
gaaggttgttatggagtcgatggggagagtgactctattatgagttcggcttctgaaaac
tccactgagccttggttttgtgatgcctgtaaatgtggtgtatctcctagctgtgaacta
tgtcctaatcaggatgggattttcaaggagacggatgctggaagatgggtccacattgtt
tgtgccctatatgttcctggagtggcttttggagatattgataaattacgaccagtaacg
ctaacagaaatgaactattctaaatatggtgccaaggagtgtagcttttgtgaagatcct
cgctttgctagaactggagtttgcattagctgtgatgcaggcatgtgtagagcctatttc
catgtcacctgtgcccaaaaggaaggcctgctatcagaggcagcagcagaagaggatata
gcagatccattttttgcttattgtaagcagcatgcagacagattagacagaaaatggaaa
agaaaaaactacttggctctacaatcctattgtaaaatgtctttgcaagagagagaaaaa
cagctgtcccctgaagcacaggcaaggatcaatgcccgactacagcaatatcgtgccaag
gcagagctggcgcgatctaccagaccacaagcctgggttccaagggaaaagctacccagg
ccactgacaagtagtgcttcggctattcgtaagcttatgcgcaaagcagagctgatggga
atcagtacggatatctttccagtggacaactcagatactagttctagtgtggatggaagg
cggaagcataagcagcccgctctcactgctgattttgtgaattactattttgagagaaat
atgcgcatgattcaaattcaggaaaatatggctgaacaaaagaatataaaggataaatta
gagaatgagcaagaaaagcttcatgtagaatataataagctctgtgaatcattagaggaa
ctgcaaaatctgaatgggaaacttcgaagtgaagggcaagggatatgggccttacttggc
cgaattacagggcagaagttgaatgtaccagcaatcttacgagcacctaaggaaaggaaa
ccaagtaaaaaagaaggaggcacacaaaagacatctgctcttcctacagtgctttatagt
tgtggaatttgtaagaagaaccatgatcagcatcttcttttactgtgtgacacctgtaaa
ctgcattatcatctcggctgccttgatcctcctcttacaaggatgccgagaaagacgaaa
aacagttactggcaatgctcagagtgtgaccaggcagggagcagcgacatggaagcagag
atggccatggaaaccttaccagatggaacaaaacgatcaaggagacagattaaggagcca
gtgaagtttgtgccacaggatgtcccaccagaacccaagaagattccaataagaaacacg
agaaccagaggacgaaagcgaagctttgttcctgaggaagaaaaacatgaggaaagagtt
cctagggaaaggaggcagaggcagtctgtgttacagaagaagcccaaggctgaggactta
agaactgagtgttcaacttgcaaaggaactggagataatgagaatcttgtcaggaacctc
agctga

DBGET integrated database retrieval system