KEGG   Mus musculus (mouse): 75744
Entry
75744             CDS       T01002                                 

Gene name
Svip, 1700006C13Rik, 6620401M08Rik
Definition
(RefSeq) small VCP/p97-interacting protein
  KO
K14014  small VCP/p97-interacting protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    75744 (Svip)
SSDB
Motif
Pfam: SVIP DHC_N1
Other DBs
NCBI-GeneID: 75744
NCBI-ProteinID: NP_001153817
MGI: 1922994
Ensembl: ENSMUSG00000074093
Vega: OTTMUSG00000059018
UniProt: Q3UZP4 Q3TYK1
Position
7; 7 B4
AA seq 77 aa
MGLCFPCPAESAPPSPSPEEKREKLAEAAERRQKEAATRGILDIQSVEAKKKKKEQLEKQ
MATSGPPTAGGLRWTVS
NT seq 234 nt   +upstreamnt  +downstreamnt
atggggctgtgcttcccttgtcccgcggagtccgcaccaccatccccgagcccggaagag
aaaagagaaaagctggcagaggcagcagaaagaaggcagaaggaggcggcgactcggggg
attttggacatccagtcagtggaggcaaaaaagaagaagaaggaacagttagaaaagcag
atggcgacatcggggccaccaacggcagggggacttagatggacggtgtcatga

DBGET integrated database retrieval system