KEGG   Mus musculus (mouse): 75761
Entry
75761             CDS       T01002                                 

Gene name
Apol7a, 9130022K13Rik, A, Apol3
Definition
(RefSeq) apolipoprotein L 7a
  KO
K14480  apolipoprotein L
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    75761 (Apol7a)
SSDB
Motif
Pfam: ApoL Zip DASH_Dam1 Fungal_trans_2
Other DBs
NCBI-GeneID: 75761
NCBI-ProteinID: NP_001158112
MGI: 1923011
Ensembl: ENSMUSG00000010601
Vega: OTTMUSG00000042028
UniProt: B2RT54 Q8BUC6 Q9D2Y0
Position
15; 15 D3
AA seq 418 aa
MDTPDRECFVESVVNYLLDTWSTEDLRLLLTEEETWKHFVAEVDLSREEEAALQESLAEI
FADPDGEDEDELQNDLQDKNERKEEDSLSEDLGESVADTDVEDEDGDAEDEDSDTEDEDR
DIEDENSNREDEDSDTEDEDSDTEGEDSNTEDEEEIQNDLWHKERFLDAYPQVKLELEEI
IRKLHALADKVDKVHRDCTISRVVASSSSAVSGVLIILGLSLAPVTAGVSLALSATGLGL
GAAAAVTSVSTSIVEKVSVVSAEDEASKLVPTNKDTMKGMKEVLDQSGPRLLSLSTDTIQ
RLQGIQKCINAIPLAKANTRLANNAKRLMTTGKISARNTKQVQKAFGGTALAMTKGARIM
GAATAGFFLLQDVISLVEDSKHLHEGAKSQTAAELRKQAQDLEQKLQELKEVHDSLTK
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggacaccccagacagagaatgctttgttgagagtgtggttaactacctcctggacaca
tggagcacagaggacctgcggctcctgctgacagaagaagaaacctggaaacactttgtg
gcagaagttgatttgtccagggaagaggaagctgccttgcaggaatctcttgctgagatc
tttgcagatcctgatggagaagatgaagatgagctccaaaatgaccttcaggacaagaac
gagaggaaagaggaagattccttgagtgaagatcttggtgagagtgtagctgatactgat
gtagaagatgaagatggtgatgcagaagatgaagatagtgatacagaagatgaagataga
gatatagaagatgaaaatagtaatagagaagatgaagatagtgatacagaagatgaagat
agtgatacagaaggtgaagatagtaatacggaagatgaagaggagatccaaaatgatctg
tggcacaaggaaaggttcttggatgcttatcctcaggtgaaactggagcttgaggagatc
atcaggaagctccacgccctggcagacaaggttgacaaggtgcacagggactgcaccatc
tcacgggtggtggccagctccagcagtgctgtgtctggagtcctgatcatccttggtctg
tctctggcacctgtgacagcaggagtcagtctggcattgtcagccactggcttggggctg
ggggcagcagcggctgtgactagtgtttccacaagcattgtggaaaaggtaagtgtggtg
tctgctgaagatgaagccagcaagctggtgccaaccaacaaagacacaatgaagggcatg
aaagaagttttggatcagagtggtcccagacttctttctttatctacagacaccattcag
agattgcaaggcattcagaaatgcattaatgccattccgctggccaaagccaacactcgc
ctagcaaataatgccaagcgtctcatgaccacagggaagatatctgcccgaaacactaaa
caggtgcagaaagcctttggaggtaccgctctggcaatgaccaaaggagcccgaatcatg
ggtgcagccactgcaggtttcttccttctgcaggatgtgatcagccttgtggaagactcg
aagcatttgcatgaaggtgctaagtcacagactgctgcagagctgaggaagcaagctcag
gacctggagcagaagttacaggagctcaaagaggttcatgacagcctgactaagtga

DBGET integrated database retrieval system