KEGG   Mus musculus (mouse): 75767
Entry
75767             CDS       T01002                                 

Gene name
Rab11fip1, 2010200K21Rik, 4833414G05Rik, Rcp
Definition
(RefSeq) RAB11 family interacting protein 1 (class I)
  KO
K12484  Rab11 family-interacting protein 1/2/5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    75767 (Rab11fip1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    75767 (Rab11fip1)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    75767 (Rab11fip1)
SSDB
Motif
Pfam: C2 RBD-FIP
Other DBs
NCBI-GeneID: 75767
NCBI-ProteinID: NP_083699
MGI: 1923017
Ensembl: ENSMUSG00000031488
Vega: OTTMUSG00000060990
UniProt: Q9D620
Position
8; 8 A2
AA seq 645 aa
MSLAASAGRGPGTMWSPTHVQVTVLQARGLRAKGPGGTSDAYAVIQVGKEKYATSVSERS
LGAPVWREEATFELPPLLSSGAAPAAAATLQLTVLHRALLGLDKFLGRAEVDLRELHRDQ
GRRKKQWYTLKSKPGKKDKERGEIEVDIQFMRNNMTASMFDLSMKDKSRNPFGKLKDKIK
GKNKDSASDTASAIVPSVTPSVDSDDESFSKDKKKKSKIKTLFSKSSLQKTPLSQSMSVL
PTSKSDKVLLRAGDFQSQWDDDAHEDESSSASDVMSHKRTSSTDQQPNQSNFSLPKKEGL
SFLGGLRSKNDSLSRSTVCINGNHVYMEQPEARSEIRESSPSNSPSPQGFRRKHLFSSTE
NLAARSPKEPGEGGGTSSDRRLSDSSTKDSMKSMSLPSYRPLTSGDNRESMSPANVEAAR
ETKDSKKQESKKSSLLSLVTGKRDAAAKGSESEPLPTVSEKEKERKGALVEAQLREEDLM
RRPEKDALPVASQWGSSLNPFEDVQISDPGATTESRSEPKPPVPAARVPQTKAVKPRPHP
VKPMNTTATKIANSSLGTATIITENLISEALMKKYQPSDPAFAYAQLTHDELIQLVLKQK
ETISKKEFQVRELEDYIDNLLVRVMEETPNILRVPAQMGKKAGKM
NT seq 1938 nt   +upstreamnt  +downstreamnt
atgtccctggcggcctcagcgggccggggcccggggaccatgtggtcccctacccacgtg
caggtgacggtgctacaggcgcggggcttgcgggccaagggacccgggggcacgagcgac
gcgtacgcggtgatccaggtgggcaaggagaagtacgccacgtcggtgtcggagcgcagc
ctgggcgcgcccgtgtggcgcgaggaagccaccttcgagctgcctccgctgctgtcctcc
ggggccgcgccggccgccgccgccaccctgcagctcaccgtcctgcaccgcgcgttgctc
ggtctcgataagttcctgggccgcgccgaggtggacctgcgggagctgcaccgggaccag
ggccgcaggaagaagcaatggtacaccctgaagtccaaacccgggaagaaggacaaagag
cgcggggaaatcgaggtcgacatccagtttatgaggaataacatgacggccagcatgttt
gacctctccatgaaagacaagtcccggaatccatttggaaaactgaaggacaagatcaaa
gggaagaataaggacagcgcctcggataccgcctcggccatcgtccccagcgtgacaccc
tcagtcgacagtgacgatgagtccttctcgaaagacaagaaaaagaagtcaaagatcaag
actttgttttccaagtcgagtctgcagaagacgcccctctcccagtccatgtctgtcctg
cccacttccaagtcagacaaagttctgttgcgggccggagacttccagtcccagtgggac
gatgacgcccatgaggatgagtcctcctccgcctcggatgtcatgtctcacaagcgaaca
tccagtacagaccaacaaccgaaccagtccaacttcagccttcccaagaaagaggggctt
tccttccttgggggcctccggtccaagaatgactctctttcccgctctaccgtctgtatc
aacgggaaccacgtttacatggagcagccggaggccaggagtgagatcagagagagcagc
ccttctaattccccatccccgcagggcttcaggaggaagcatttgttctcgtccactgaa
aacctggctgcccgctctcccaaggaaccaggggaaggaggcggcacatcttctgacagg
cgactgtccgactcttccaccaaggattccatgaagtccatgtctttgccatcctaccgg
cctctgaccagtggggacaatagagagagcatgtctccagcaaacgtggaggctgccaga
gagacaaaagacagcaagaaacaggagagcaagaagtcctctttgctttctctggtgacg
ggaaagagggatgcggcggctaaaggcagtgaaagcgaacctcttcccactgtctcagag
aaagagaaggagaggaaaggcgcgctcgtggaagcccagctgcgggaggaagacctcatg
agaaggcctgagaaagatgctctacctgttgcctcccagtggggcagctccttgaacccc
tttgaggacgtgcagatctcagacccgggagccaccacggagtccaggtcggaaccgaaa
ccaccagttcctgcggccagggttccccagaccaaggctgtgaagccgaggcctcaccct
gtgaagcccatgaacacaacagccaccaagattgcaaactctagtttgggaaccgccacc
atcatcactgagaacctgatcagcgaggccctcatgaagaaataccagccctcggatccc
gcctttgcctacgcgcagctgacccacgatgagctgatccagctagtcctcaaacagaag
gagaccatcagcaagaaggagtttcaggtgcgggagctggaggactacatcgacaacctg
ctagtcagagtcatggaggagacccccaacatcctccgagtgccggcgcagatgggcaag
aaggccggaaagatgtaa

DBGET integrated database retrieval system