KEGG   Mus musculus (mouse): 75770
Entry
75770             CDS       T01002                                 

Gene name
Brsk2, 4833424K13Rik, SAD-A, SADA
Definition
(RefSeq) BR serine/threonine kinase 2
  KO
K08796  BR serine/threonine kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    75770 (Brsk2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    75770 (Brsk2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    75770 (Brsk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     75770 (Brsk2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   75770 (Brsk2)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    75770 (Brsk2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     75770 (Brsk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Choline_kinase Kdo
Other DBs
NCBI-GeneID: 75770
NCBI-ProteinID: NP_001009930
MGI: 1923020
Ensembl: ENSMUSG00000053046
Vega: OTTMUSG00000036942
UniProt: Q69Z98
Structure
PDB: 
4YNZ 4YOM

Position
7; 7 F5
AA seq 719 aa
MTSTGKDGGGAQHAQYVGPYRLEKTLGKGQTGLVKLGIHCVTCQKVAIKIVNREKLSESV
LMKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEAR
KFFRQIISALDFCHSHSICHRDLKPENLLLDERNNIRIADFGMASLQVGDSLLETSCGSP
HYACPEVIRGEKYDGRKADVWSCGVILFALLVGALPFDDDNLRQLLEKVKRGVFHMPHFI
PPDCQSLLRGMIEVDAARRLTLEHIQKHIWYIGGKNEPEPEQPIPRKVQIRSLPSLEDID
PDVLDSMHSLGCFRDRNKLLQDLLSEEENQEKMIYFLLLDRKERYPSHEDEDLPPRNEID
PPRKRVDSPMLNRHGKRRPERKSMEVLSVTDGGSPVPARRAIEMAQHGQRSRSISGASSG
LSTSPLSSPRVTPHPSPRGSPLPTPKGTPVHTPKESPAGTPNPTPPSSPSVGGVPWRTRL
NSIKNSFLGSPRFHRRKLQVPTPEEMSNLTPESSPELAKKSWFGNFINLEKEEQIFVVIK
DKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGG
EAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTHDQPSAQHLSDTTNCMEVMTGRL
SKCDEKNGQAAQAPSTPAKRSAHGPLGDSAAAGPGGDTEYPMGKDMAKMGPPAARREQP
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgacatcgacggggaaggacggcggcggggcgcagcacgcgcagtatgtggggccctac
cggctggagaagacgctgggcaaggggcagacaggcttggtgaagctgggaatccactgt
gtcacttgccagaaggtcgccatcaaaatcgtgaaccgtgagaagctcagtgagtcggtg
ctgatgaaggtggagcgagagattgccatcttgaagctcatcgagcatccacatgtactg
aagctgcatgacgtctatgaaaacaaaaaatatttatacctggtgctagaacatgtgtct
gggggagagctgttcgactacctggtgaagaagggccggctgacccccaaggaggcccgc
aagttcttccggcagatcatctctgcactggacttctgtcacagccactccatatgccat
agagacttgaagccagagaacctgctgctagatgagaggaacaacatccgtattgcagac
tttggcatggcatccctgcaggtgggagacagcctgctggagaccagctgcggatctcca
cactatgcctgtccggaagtgattcggggcgagaagtatgatggccgcaaggcagatgtg
tggagctgtggtgtgatcctgttcgccttgctggtgggggctctgccttttgatgatgac
aacctgcggcagttgctggagaaggtcaagcgtggtgtgttccacatgccacactttatc
ccaccagactgccagagtctcctgcgtggcatgattgaggtggatgcagctcggcgcctc
acgctagagcacattcagaaacacatatggtatataggtggcaagaatgagccagagccc
gaacagcccatcccacgcaaggtgcagatccgctcactacccagcttggaagacattgac
cctgatgtgttggacagcatgcactcactgggctgcttccgagaccgcaacaagctgctg
caggatctgctatctgaggaggagaatcaggaaaagatgatttatttcctcctcctggat
cggaaagaacggtatccaagccatgaggatgaggacctgccccccaggaatgagatagac
cctccccggaagcgtgtggattccccgatgctgaaccggcatggcaagcggcgacctgag
cgcaagtccatggaagtgctcagtgtgacagatggtggctccccagtgcctgcacggaga
gccattgagatggcccagcatggccagagatctcgatccatcagtggtgcgtcctcaggc
ctttctacaagtccactcagcagtcctcgggtgacccctcacccctcaccaaggggtagt
ccccttcctacccccaaagggacgcctgtccacacgccaaaggagagcccagctggcaca
cccaaccccacaccaccatccagccctagtgttggaggagtgccctggcggacacgactg
aactccatcaagaacagcttcctgggctcacctcgattccaccgccggaaactccaagtt
cccacgccagaggagatgtccaacctgaccccagaatcctctccagagctggccaagaaa
tcgtggttcgggaacttcatcaacctggagaaggaggagcagatctttgtggtgatcaag
gacaagcccctgagctccatcaaggctgacatcgttcatgccttcctgtcgatccccagc
ctcagccacagcgttatttcccagacaagcttcagggctgaatacaaggccacagggggc
ccagcagtgttccagaagccggtcaagttccaggtggacatcacctacactgagggcgga
gaggcccagaaggagaatggcatctactcagtcacattcactttactctcaggccccagt
cgccgcttcaagagggtggtggagaccatccaggcccagctgttaagcacccatgaccag
ccatcagcccagcacctgtcagacaccactaactgtatggaagtgatgacggggcggctt
tccaaatgtgacgagaagaacgggcaggcggcccaggcccccagcacacccgccaagcgg
agtgcccacggccccctgggtgactccgcggccgctggccctggaggggacaccgagtac
ccgatgggcaaggacatggccaagatggggccgcccgccgcccgccgtgagcagccttag

DBGET integrated database retrieval system