KEGG   Mus musculus (mouse): 75778
Entry
75778             CDS       T01002                                 

Gene name
Them4, 2700077M13Rik, 4921507I02Rik
Definition
(RefSeq) thioesterase superfamily member 4
  KO
K16339  acyl-coenzyme A thioesterase THEM4 [EC:3.1.2.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00062  Fatty acid elongation
mmu04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    75778 (Them4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    75778 (Them4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     75778 (Them4)
SSDB
Motif
Pfam: 4HBT
Other DBs
NCBI-GeneID: 75778
NCBI-ProteinID: NP_083707
MGI: 1923028
Ensembl: ENSMUSG00000028145
Vega: OTTMUSG00000029592
UniProt: Q3UUI3
Position
3; 3 F2.1
AA seq 230 aa
MLRNCAMRLRTLGATPARRPGAARRLFSSEKVIRKDYALPNPSWTKDLRLLFDQFMKKCE
DGSWKRMPSHRQNPTRAIQEFQTLFVDSKFKKEEQMSKAQQFTRSFEEGLGFEYAMFYNK
VEKRTVSLFQGGLHLQGVPGFVHGGAIATIIDVTTGTCAISEGVAMTANLNITYKKPIPL
LSVVVVNSQLQKIEGRKLFVSCTIQSIDEKTLYTEATALFIKLDPEKPLT
NT seq 693 nt   +upstreamnt  +downstreamnt
atgctgagaaactgcgctatgcgcctgcgcactcttggggccacgcctgcgaggcggcca
ggagcagctaggaggttattttcttctgagaaagtcattcgtaaggactatgctctccct
aaccccagctggactaaggacctcagactcctttttgatcagttcatgaagaaatgtgaa
gatggctcctggaaacgcatgccttcacacagacaaaaccctactcgagctattcaagag
ttccaaaccctttttgttgactcgaagtttaagaaagaagaacaaatgtcaaaggcccaa
cagttcaccagaagtttcgaggaagggctaggctttgagtatgcgatgttctataataaa
gttgagaagaggacggtctccttgtttcaaggaggacttcacctgcaaggagtacctgga
tttgttcacggaggtgccattgcaaccatcattgatgtcactactggcacgtgtgcaatt
tccgaaggcgttgccatgactgccaacctcaacatcacctataaaaagcctatccccctt
ctttctgttgttgtggtaaatagccaacttcaaaaaattgaaggaaggaaactttttgtt
tcctgtactattcaaagtattgatgagaagactttatacacagaggcaacggccttattt
ataaagctggatcctgagaaacctttgacataa

DBGET integrated database retrieval system