KEGG   Mus musculus (mouse): 75801Help
Entry
75801             CDS       T01002                                 

Gene name
4930447C04Rik, 4921504I02Rik, A930035O15Rik, Six6OS, Six6as, Six6os1
Definition
(RefSeq) RIKEN cDNA 4930447C04 gene
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: S6OS1
Motif
Other DBs
NCBI-GeneID: 75801
NCBI-ProteinID: NP_083720
MGI: 1923051
Ensembl: ENSMUSG00000021098
Vega: OTTMUSG00000032630
UniProt: Q9CTN5
Position
12; 12 C3
AA seq 574 aa AA seqDB search
MNDNLFVSLDRLLLEFVFQYEQDISIKEDTIQRINKCLESIKENKANVSKLREAINKVDE
DIAFHYKHSKEIKDSCSNWKPTCDVFHKHEDYIKDQLTAYQETNEKDKKMYHDYICQYED
VLKQYQLKYSETRFSCKYYEKKKEHEEIKNRVLACTEQLQLNETILMKFLVPAPFPSLTK
WTLYVVNLRYRTQDILKRANNFTKRSFELEKEADDMEIEINSLNKMARLFESKTFSEALD
EKNKNTEKRKEFEERIFEKDEQVSNRSSQNSQLLLPCESQKFVRNMNSSEARVTDKKEES
SANQSKFVRSDVRQKENNPQIFNDSGMDSNSKSSHIPAVKSSQGFMQFRLNQPNYNQRIE
KEHIDAECGDKETVRQVRESKCSTQALYIEHFGKSIENNSVEEERDENFPQTPETPSFLR
TPEALKTPESMEKMQFPKSPFFEITKNATSEGHKQKDSPGFSFLMSYTSRSPGLNLFDSS
VSDSEISSDQFNEHYSAVNLNPSSSQQGIGNLFGKSEGEDAFTFSFSSDSSHTFGAGKDD
FSFPFSFEQDPSTMTSSSSKDFSSSQNKTQFMFF
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaatgataatctgtttgtcagtttggacaggcttttgttggaatttgttttccagtat
gagcaagacataagtattaaagaagatacgattcaaagaattaataaatgccttgaaagt
attaaagaaaataaagcaaatgtttctaagctacgtgaagctataaacaaagtagatgag
gacattgcttttcactataaacatagtaaagaaatcaaagacagctgtagtaactggaag
ccaacatgtgatgtttttcataaacatgaagattatataaaagaccagcttactgcttac
caagaaaccaatgagaaagacaaaaaaatgtatcatgattatatatgtcagtatgaagat
gttttgaaacaataccaactaaaatactcagaaacacgtttttcatgtaaatattatgag
aagaaaaaagaacatgaagaaattaaaaatagagtgttggcatgtactgaacaactacaa
ttgaatgaaactattcttatgaaatttctagtgcctgctcctttcccatctctgactaaa
tggacattatacgtagttaatttgagatacagaacacaagatattcttaaacgtgccaac
aattttaccaaaagatcatttgaattggagaaagaagcagatgatatggaaatagaaatt
aattctttaaataagatggcaagactttttgaaagtaaaacattttcagaagctctagac
gaaaagaacaaaaatacagaaaagagaaaagaatttgaagagagaatttttgaaaaagat
gagcaagtatcaaacagaagctctcaaaatagccaattgttactgccatgtgagtctcag
aaatttgtaagaaatatgaattcttcagaagcaagagttacagataaaaaagaagaaagt
tcagccaatcagtcaaagtttgttagaagtgatgtgagacaaaaagaaaataatccacag
atatttaatgactctggtatggatagtaattcaaaatcttcacatattccagctgttaaa
agttcacaaggttttatgcaattcagattgaatcaaccaaattacaatcaacggattgaa
aaagaacatatagatgctgaatgtggagataaagagacagtaagacaagtaagagaatca
aaatgtagtacacaggccctatacattgaacactttggaaagtccatagaaaataatagt
gttgaagaggaaagagatgagaattttcctcaaactcctgaaactccttcatttctaaga
actcctgaagcgctgaagacacctgaatctatggagaaaatgcagttccctaaaagcccc
ttctttgaaataactaaaaatgcaacatctgaaggacataaacaaaaggattctcctgga
ttttcatttcttatgagttacacctctagatcacctggactaaatttatttgattcttct
gtatctgattcagaaatctcatcggatcagtttaatgaacattactctgcggtaaatcta
aatccttcttcatcacaacaaggaattggaaacttatttggaaaatcagaaggagaagat
gccttcacattttctttttcatcagactcttctcacacatttggagctggaaaagatgac
tttagttttccattttcttttgaacaggatccaagcacaatgacttcttcttcctcaaaa
gatttttcatcctcacaaaataaaacacaatttatgtttttttga

DBGET integrated database retrieval system