KEGG   Mus musculus (mouse): 75826
Entry
75826             CDS       T01002                                 

Gene name
Senp2, 2310007L05Rik, 4930538C18Rik, AI646780, AW554757, Smt3ip2, SuPr-1, mKIAA1331
Definition
(RefSeq) SUMO/sentrin specific peptidase 2
  KO
K03345  sentrin-specific protease 2 (axin associating molecule) [EC:3.4.22.68]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    75826 (Senp2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    75826 (Senp2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    75826 (Senp2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    75826 (Senp2)
   04121 Ubiquitin system [BR:mmu04121]
    75826 (Senp2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.68  Ulp1 peptidase
     75826 (Senp2)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C48: Ulp1 endopeptidase family
   75826 (Senp2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     75826 (Senp2)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   75826 (Senp2)
SSDB
Motif
Pfam: Peptidase_C48
Other DBs
NCBI-GeneID: 75826
NCBI-ProteinID: NP_083733
MGI: 1923076
Ensembl: ENSMUSG00000022855
UniProt: Q91ZX6
Position
16; 16 B1
AA seq 588 aa
MYRWLAKVLGTILRLCERPAPGARALLKRRRSSSTLFSTAVDTDEIPAKRPRLDCFIHQV
KNSLYNAASLFGFPFQLTTKPMVSSACNGTRNVAPSGEVFSNSSSCELMSSGSCSSMLKL
GNKSPNGISDYPKIRVTVTRDQPRRVLPSFGFTLKSEGYNRRPSGRRHSKSNPESSLTWK
PQEQGVTEMISEEGGKGVRRPHCTVEEGVQKDEREKYRKLLERLKEGAHGSTFPPTVSHH
SSQRIQMDTLKTKGWVEEQNHGVRTTHFVPKQYRVVETRGPLCSMRSEKRYSKGKADTEK
VVGLRFEKEGTRGHQMEPDLSEEVSARLRLGSGSNGLLRRKISVLEIKEKNFPSKEKDRR
TEDLFEFTEDMEKEISNALGHGPPDEILSSAFKLRITRGDIQTLKNYHWLNDEVINFYMN
LLVERSKKQGYPALHAFSTFFYPKLKSGGYQAVKRWTKGVNLFEQELVLVPIHRKVHWSL
VVMDLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRNTDLNLLEWTHYSMKPHEIPQ
QLNGSDCGMFTCKYADYISRDKPITFTQHQMPLFRKKMVWEILHQQLL
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgtacagatggctggctaaggttctcggcaccattcttcgcttgtgtgagcggcccgcg
cccggggcccgcgccctactcaagaggcggcgctccagcagcactctgttttctactgca
gtggacactgatgagatcccagccaaaaggccaagattagattgctttattcaccaagtg
aagaacagtctctacaatgctgccagtttatttggattcccgttccagctgaccacaaaa
cccatggtgtcttctgcttgtaatggaacacggaatgtggccccttctggagaggtcttt
tcgaactcttcatcttgtgagctgatgagttctggatcctgcagcagcatgctgaaactg
ggtaataaatctcctaatggaataagcgactatccaaagatcagagtgacagtgacccgc
gatcagccacggagagtcctgccctcctttggttttacgctgaaatcggaaggctataat
agaaggccaagtggtcgtcgccatagcaaaagcaatccagagagttccttaacatggaag
cctcaggagcaaggtgtgacagagatgatttctgaagagggtggcaagggtgtgaggcgt
ccccactgcaccgtggaggagggtgtccaaaaggatgaaagagaaaagtatcgaaagtta
ttggagcgacttaaagaaggtgctcatggaagcacgttccctcccacggtttcacaccac
agttctcagagaattcagatggacacattaaagaccaaaggctgggtggaggagcagaat
catggcgtcagaacaacccattttgttccaaaacagtatagagttgttgaaacaagagga
cctctctgttcaatgagaagtgaaaagaggtattcaaaagggaaagctgatacagagaag
gtggtgggactccgatttgaaaaggaaggtacaagaggacaccaaatggagcctgatctg
tcagaagaagtgtctgcccgacttcgtctaggaagtggaagcaatggcttactcagaagg
aaaatatcagtgcttgagataaaggaaaagaacttcccgagcaaagagaaggacagaaga
acggaagacctctttgaatttacagaggacatggaaaaggaaatcagtaatgccctgggc
cacggcccaccagatgagattttgagcagcgctttcaagttgcgaatcacccgcggagac
atccagaccttaaagaactatcattggctcaacgatgaggtcattaatttttatatgaat
cttttagtggaaaggagtaaaaagcaaggttatccagcacttcatgcattcagtacattc
ttctatcctaagctaaagtctggaggttaccaagcagtgaaaagatggaccaaaggggta
aatctcttcgaacaagaacttgttctggtacctattcatcggaaggtacattggagcctg
gtggtgatggacctaagaaaaaagtgtcttaaatatctggattctatgggacaaaaaggc
cacaggatctgtgagattcttcttcagtatttacaggatgaaagcaagaccaaaagaaat
acagatctcaacctcttagagtggacccactacagcatgaagccacatgagattcctcag
cagttgaatgggagtgactgtggaatgtttacttgtaaatatgcagattatatttctagg
gacaaacctatcacattcactcagcaccagatgcctctcttccggaagaagatggtgtgg
gagatccttcaccagcagttgctgtga

DBGET integrated database retrieval system