KEGG   Mus musculus (mouse): 75829
Entry
75829             CDS       T01002                                 

Gene name
Prame, 4930534P07Rik
Definition
(RefSeq) preferentially expressed antigen in melanoma
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: LRR_6
Other DBs
NCBI-GeneID: 75829
NCBI-ProteinID: NP_083735
MGI: 1923079
Ensembl: ENSMUSG00000031411
Vega: OTTMUSG00000018772
UniProt: Q9D4Z5
Position
X; X F1
AA seq 464 aa
MMMDERDPSSLLDLAIQSLLSNELVAIHSLGEIPRELFVPLFSAAFTGGYRKILTSMVKI
WPFTCLHIGTLSVQEPQRELLKAMVESLQFLPAQDCSSGGPKLRILDVRQGVDCKTTCPD
FGARSPTCFHGCTHSVHSILKLESQYSIVDLKPESQSAIQPMELLVDLSLDGTLREREFF
ALLLNKVQQSSGSLHLCCRDLQIDRFSYAKNALKFLDLTCIQNLTVDQASLSEVTTLLAR
MIYLDSLSLSKITYRSLHGKVFRVFLNYLGRMNCLKELNLSSFSLTDHLDSLLRALPPNL
DFLYLPFCEISYRDLKFLSQSAQATHLKLLNLSNNPMYWDDCGPFQTLLQKLSDTLQHLA
INHCHLTDAILSAILPALSKCSHLRVISFVSNPISMPMLLKILHYLTPLMELKYVIYPIP
IHCYEQWQFHGRLDRQKLTDVQAQLKAMLQAAKRSDMNWITYSQ
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgatgatggatgaaagagacccatcctcgcttttggatctggctatacagagtctacta
agtaatgagcttgtagcaattcattctctgggggagatcccaagggagctttttgttcca
ttgttctctgctgccttcacgggaggatataggaagatactgacttcaatggtgaagatt
tggccttttacctgtctccacattggaacattaagtgtacaggaaccccagcgtgaactc
ctgaaagccatggttgagagtcttcagtttcttcctgcccaggactgttcttctgggggc
cctaagttgaggatcctagatgtaaggcagggtgttgactgcaagacaacatgccctgat
tttggtgccagatctccaacttgttttcatggttgtactcactctgtacactctattctg
aagttagaaagccagtacagcattgtagatctaaagcccgagagtcagtctgcaatccag
cctatggaactactagtagacctttcccttgatggtaccttgagagaaagggaatttttt
gctttgcttctgaataaagtacagcagagctcagggtctttgcacctctgctgccgagat
ctacaaattgatagattttcttatgccaaaaacgctctgaagttcctcgatctaacttgc
attcagaacctgacagttgatcaggcttcactgagtgaagtcaccactcttctggctcgc
atgatctatctggacagcctgagtctctctaaaatcacttatagatctttgcatgggaaa
gtcttccgagtgttcctcaactatcttgggcggatgaactgcctgaaagagctcaacctg
tcttcctttagcctcacagaccatctggatagcctcctcagagccttaccacctaatttg
gatttcttgtatctgccgttctgtgaaatttcttacagagatctcaaatttctatcccag
agtgctcaggccacccacttaaagctgttgaatcttagtaacaacccaatgtattgggat
gattgtgggccttttcagactcttttgcagaagctctcagataccttgcagcatctggcc
ataaaccattgccatttaacagatgccatactctctgctattctgccagcactatctaag
tgttcccatctccgtgtgattagctttgtctctaaccccatttcaatgcctatgctcctg
aaaattcttcattacttaacacctttgatggagctgaaatacgtgatttaccctatccct
atacattgctatgaacaatggcaatttcatggcagattagaccggcagaagctcaccgat
gtccaagcacaactgaaggcaatgctacaagcagcaaaaaggagtgacatgaactggatc
acttattctcagtaa

DBGET integrated database retrieval system