KEGG   Mus musculus (mouse): 75914Help
Entry
75914             CDS       T01002                                 

Gene name
Exoc6b, 4930569O18Rik, G430127E12Rik, Sec15b, Sec15l2, mKIAA0919
Definition
(RefSeq) exocyst complex component 6B
  KO
K19985  exocyst complex component 6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    75914 (Exoc6b)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Tethering complex
   Exocyst complex
    75914 (Exoc6b)
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    75914 (Exoc6b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec15 Sec8_exocyst COG5 Vps51 COG2
Motif
Other DBs
NCBI-GeneID: 75914
NCBI-ProteinID: NP_796051
MGI: 1923164
Ensembl: ENSMUSG00000033769
Vega: OTTMUSG00000034535
UniProt: A6H5Z3
Position
6; 6 C3
AA seq 810 aa AA seqDB search
MERAKMAEESLETAAEHERILREIESTDTACIGPTLRSVYDGEEHGRFMEKLETRIRNHD
REIEKMCNFHYQGFVDSITELLKVRGEAQKLKNQVTDTNRKLQHEGKELVIAMEELKQCR
LQQRNISATVDKLMLCLPVLEMYSKLRDQMKTKRHYPALKTLEHLEHTYLPQVSHYRFCK
VMVDNIPKLREEIKDVSMSDLKDFLESIRKHSDKIGETAMKQAQQQRNLDNIVLQQPRIG
SKRKSKKDVYTIFDAEVESTSPKSEQDSGILDVEDEEDDEEVPGAQDLVDFSPVYRCLHI
YSVLGARETFENYYRKQRRKQARLVLQPPSNMHETLDGYRKYFNQIVGFFVVEDHILHTT
QGLVNRAYIDELWEMALSKTIAALRTHSSYCSDPNLVLDLKNLIVLFADTLQVYGFPVNQ
LFDMLLEIRDQYSETLLKKWAGVFRNILDSDNYSPIPVTSEETYKKVVGQFPFQDIELEK
QPFPKKFPFSEFVPKVYNQIKEFIYACLKFSEDLHLSSTEVDDMIRKSTNLLLTRTLSNS
LQNVIKRKNIGLTELVQIIINTTHLEKSCKYLEEFITNITNVLPETVHTTKLYGTTTFKD
ARHAAEEEIYTNLNQKIDQFLQLADYDWMTGDLDNKASDYLVDLIAFLRSTFAVFTHLPG
KVAQTACMSACKHLATSLMQLLLEAEVRQLTLGALQQFNLDVRECEQFARSGPVPGFQED
TLQLAFIDLRQLLDLFIQWDWSTYLADYGQPNCKYLRVNPVTALTLLEKMKDTSRKNNMF
AQFRKNERDKQKLIDTVAKQLRGLISSHHS
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggcgaagatggcggaggagagcctggagacggcggcggagcacgagcggatc
ctgagggagatcgagagcacagacacggcctgcatcgggcccacgctcaggtctgtctat
gatggtgaggaacatggacgattcatggagaagctagaaactcgtatccgcaatcatgac
agagaaatcgagaaaatgtgcaactttcactaccagggctttgtggactctattactgag
ctgctgaaagtacgaggagaagcccagaaactcaaaaaccaggtgacggacactaatagg
aaactgcagcacgagggcaaggaactggtaatagcaatggaggagctgaagcagtgtcga
ctacaacagagaaatatttctgccactgtcgataagctaatgctgtgtcttccagtccta
gagatgtacagcaaactgagggaccagatgaaaaccaaaaggcattatcctgcactgaag
acactggagcatctggaacacacctatctgcctcaagtgagccactatcgattctgtaag
gtgatggtggacaacatccccaagcttcgggaggaaataaaagatgtttctatgtctgat
ctcaaagactttctggagagcatccgcaagcattcagacaaaattggagagactgccatg
aagcaagcccaacagcaaagaaacctggataacattgtcttgcaacagcctagaataggt
agcaaaaggaaatctaagaaagatgtttatacaatctttgatgcagaggtggagagcaca
agtccaaagtcggaacaggattcgggaattctggatgtggaagacgaggaagatgatgaa
gaggtacctggggctcaagacttggtggatttctctcctgtgtatcggtgtctacacata
tattctgtcctgggtgcccgtgaaacatttgagaattactaccgaaaacagaggcgaaaa
caggctcgtttggtactccagcctccgtctaatatgcatgaaactttagatggctacagg
aagtatttcaatcaaattgtaggcttttttgtggttgaagatcacattttgcatacaacc
cagggcttagtgaatagagcctacattgatgaactgtgggaaatggccctttcaaagacc
atcgcagcattgcgtacccactcgtcctactgttctgatccaaacctcgtgttagatttg
aagaacctcattgtactctttgcggacacacttcaggtgtatggttttcctgtgaatcag
ctttttgatatgttgttagaaatcagagaccagtacagcgagactctattgaagaagtgg
gcaggggttttcagaaatatacttgattctgacaactacagtcccataccagtaacaagt
gaagagacatataaaaaagtcgtaggacaattcccgtttcaagatatagaactggaaaag
cagccatttcccaaaaagtttcctttctctgaatttgtgccaaaagtttacaaccagatt
aaagaatttatctacgcctgcctgaagttttcagaagatcttcatctaagctccactgaa
gtcgatgacatgatccgtaagtctacaaacttgttgctgaccaggactctgagcaactct
ctgcagaacgtcattaagaggaagaacattggccttactgagcttgtccagattatcatc
aatacaacacacttggagaagtcctgtaaatacctggaggaattcatcaccaatatcact
aatgtccttccagagacggtccataccaccaagctttatggtaccacaactttcaaggat
gctagacatgcagctgaagaagagatatatacaaacctaaatcagaagattgaccagttt
ctgcagctggctgactacgactggatgactggagacctagacaacaaagccagtgattac
ctggtagacctcattgccttcctccggagcacctttgctgtgttcacacaccttcctgga
aaggtggctcagacagcatgtatgtcagcttgcaagcatttagccacatccttgatgcaa
cttttgctagaagcggaagtacggcagctcactttgggagcattgcagcagttcaacctg
gatgtcagagaatgtgaacagtttgccagatccggcccggtgcctgggttccaggaggac
acgctgcagttggccttcatcgacttgagacaactattggacctctttattcagtgggat
tggtccacataccttgccgactatggacagcccaactgcaagtatctccgggtgaaccct
gtgacagctctgaccctgcttgagaagatgaaagatactagccgcaagaataacatgttt
gcacagttccggaaaaatgagcgagataagcagaaattgattgacaccgtggccaagcag
ctccgaggactcatcagcagccaccactcctga

DBGET integrated database retrieval system