KEGG   Mus musculus (mouse): 75956
Entry
75956             CDS       T01002                                 

Gene name
Srrm2, 5033413A03Rik, AA410130, SRm300, mKIAA0324
Definition
(RefSeq) serine/arginine repetitive matrix 2
  KO
K13172  serine/arginine repetitive matrix protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    75956 (Srrm2)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   SR-related proteins
    75956 (Srrm2)
SSDB
Motif
Pfam: CTD
Other DBs
NCBI-GeneID: 75956
NCBI-ProteinID: NP_780438
MGI: 1923206
Ensembl: ENSMUSG00000039218
Vega: OTTMUSG00000049491
UniProt: Q8BTI8
Position
17; 17 A3.3
AA seq 2607 aa
MLLEKDVNPGAKEETPGQRPVVTETHQLAELNEKKNERLRAAFGISDSYVDGSSFDPQRR
AREAKQIAPEPPKPYSLVRETSSSRSPTPKQKKKKKKKDRGRRSESSSPRRERKKSSKKK
KHRSESESKKRKHRSPTPKSKRKSKDKKRKRSRSTTPAPKSRRAHRSTSADSASSSDTSR
SRSRSAAAKIHTTALTGQSPPLASGHQGEGDAPSVEPGATNIQQPSSPAPSTKQSSSPYE
DKDKKEKSAVRPSPSPERSSTGPELPAPTPLLVEQHVDSPRPLAAIPSSQEPVNPSSEAS
PTRGCSPPKSPEKPPQSTSSESCPPSPQPTKGSRHASSSPESLKPTPAPGSRREISSSPT
SKNRSHGRAKRDKSHSHTPSHRAGRSRSPATKRGRSRSRTPTKRGHSRSRSPQWRRSRSA
QRWGKSRSPQRRGRSRSPQRPGWSRSRNTQRRGRSRSARRGRSHSRSPATRGRSRSRTPA
RRGRSRSRTPARRRSRSRTPARRRSRSRTPARRGRSRSRTPARRRSRTRSPVRRRSRSRS
QARRSGRSRSRTPARRSGRSRSRTPARRGRSRSRTPARRSARSRSRTPARRGRSRSRTPA
RRRSRSRSLVRRGRSHSRTPQRRGRSGSSSERKNKSRTSQRRSRSNSSPEMKKSHVSSRR
SRSLSSPRSKAKSLRRSLSGSSPCPKQKSQTPTRRSRSGSSPPKQKSKTPPRQSRSNSPQ
PKVKSGTPPRPGSVTNMQADECTATPQRQSHSESSPDGEVKSRTPSRQSCSGSSPRVKSS
TPPRQSPSRSSSPQPKVKTVISPRGRSHSSSSSPSPSRVTSRTPQRKSRSISPCPKVDSR
LRHSRSRSSSPDSKMELGTPLRHSGSTSPYLKSMLQTPPDQNLSGSKSPCPQKSRDSPTG
SSGSFHLCPGVTPSSIVPGESCFSASFVQQKGHTQTWPDTSSPEVMQTQVESPLLQSKSQ
TSPKGSLSRSSSPVTELTARSPVKQDKSEISTDPKLKSGMSPEQSKTKPDSSIYPLVDSK
SFLVQSRLEPSELKERLGLIQEDVASSCIPRDKFSPTQDRPESSTVLKVTPRVLLKERSG
AGSPPGKRDQKSLLPNSSQDELMEVEKSEQPLSQVLPSLSPEHKEMPGSNIESSPEVEER
PAVLSALDQSQSQPSKAAETPAVASCWSGPQVSPEHKELSHSPPRENSFESSLEFKNSGP
VSEVNTGFSPEVKEELNGSFLNQTEADPSVDMKEQSRSSRRSSSELSPEVVEKVGLFSSQ
KVSSPVLETVQQRTPSRERSSSASPELKDGLPRTPSRRSRSGSSPGLRDGSGTPSRHSLS
GSSPGMKDTPQTPSRGRSECDSSPEPKALPQTPRARSHSPSSPERNNKSVTPQRERSGSE
SSVEQKNLARTSPGQRSRSGSSQELDGKPSASPQERSESDSSPDSKPKTRTPLRQRSHSG
SSPEVDSKSRHSPRLSRSGSSPEMKDKPRVLQRAQSGTDSSPEHKIPAPRALPRHSRSGS
SSKERGPSPEGSSSSESSPEHAPKSRTARRGSRSSIEPKTKSHTPPRRRSSRSSPELTRK
ARVSRRSRSASSSPEIRSRTPPRRRRSPSVSSPEPTEKSRSSRRRRSVSSPRTKTTSRRG
RSPSPKPRGLQRSRSRSRREKTRTTRRRDRSGSSQSTSRRRQRSRSRSRVTRRRRGGSGY
HSRSPTRQESSRTSSRRRRGRSRTPLTSRKRSRSRTSPAPWKRSRSRASPATHRRSRSRT
PLISRRRSRSRTSPVSRRRSRSVNRRRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTRR
RSRSRTPPVTRRRSRSRTPPVTRRRSRSRTSPVTRRRSRSRTSPVTRRRSRSRTSPVTRR
RSRSRTSPVTRRRSRSRTPPAIRRRSRSRTPLLPRKRSRSRSPLAIRRRSRSRTPRAARG
KRSLTRSPPAIRRRSASGSSSDRSRSATPPATRNHSGSRTPPVALSSSRMSCFSRPSMSP
TPLDRCRSPGMLEPLGSARTPMSVLQQTGGSMMDGPGPRIPDHPRSSVPENHAQSRIALA
LTAISLGTARPPPSMSAAGLAARMSQVPAPVPLMSLRTAPAANLASRIPAASAAAMNLAS
ARTSAIPASVNLADSRTPAAAAAMNLASPRTAVAPSAVNLADPRTPAASAVNLAGARTPA
ALAALSLTGSGTPPTAANYPSSSRTPQAPTPANLVVGPRSAHGTAPVNIAGSRTPAGLAP
TNLSSSRMAPALSGANLTSPRVPLSAYDRVSGRTSPLMLDRARSRTPPSAPSQSRMTSER
ERAPSPASRMVQASSQSLLPPAQDRPRSPVPSAFSDQSRSVVQTTPVAGSQSLSSGTVAK
STSSASDHNGMLSGPAPGISHAEGGEPPASTGAQQPSTLAALQPAKERRSSSSSSSSSSS
SSSSSSSSSSSSSSGSSSSDSEGSSLPAQPEVALKRVPSPTPVPKEAIREGRPQEPTPAK
RKRRSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSPSPAKPGPQALPKP
ASPKKPPPGERRSRSPRKPIDSLRDSRSLSYSPVERRQPSPQPSPRDLQSSERVSWRGQR
GDSHSPGHKRKETPSPRSNRHRSSRSP
NT seq 7824 nt   +upstreamnt  +downstreamnt
atgttgctggaaaaggatgtgaaccctggggccaaggaagaaaccccagggcagagacca
gtggtaactgagacccatcagttggcagaactgaatgagaagaagaatgaacgactccgt
gctgcctttggcatcagtgactcctatgtggatggcagttcttttgatcctcagagacgt
gctcgagaagctaaacaaatagctcctgagcctcccaaaccatacagccttgttcgagag
accagcagttctcgctcaccaactccaaagcaaaagaagaagaaaaagaagaaagataga
ggacgcaggtcagagagcagttctcctcgacgagagaggaagaagagttcaaagaagaag
aagcacaggtcagaatctgagtccaagaaacggaaacacaggtctcctactccaaagagc
aaacgcaaatcaaaggacaagaagaggaaacggtctcgaagtacaacaccagctcctaag
agccgtcgagctcatcggtcaacttctgcggactctgcttcttcctctgatacttctcgt
agtcggtctcgaagtgctgctgctaaaattcatacaacagccttgactgggcaaagtcct
ccccttgcttcagggcatcaaggggagggagatgcaccttctgttgaaccaggtgccacc
aacatacaacaacctagtagcccagctccctctacaaagcaatctagcagtccttatgaa
gacaaagataagaaagagaaatctgcagttcgacctagcccctctccggaaaggagcagc
acagggccagaactacctgcccctactccgctccttgttgagcaacatgtcgactcccca
cgaccccttgcagcaatcccgtccagtcaggagccagttaacccctcatctgaggcttcc
ccaacccggggctgttcaccacctaagtctcctgagaaacctccccagtctacttcctca
gaaagttgcccaccatcccctcaacctaccaaaggttctcggcatgccagctcttctcct
gaaagtcttaaacccacaccagctcctgggtcccgtcgagagatttcttcttcacccaca
tctaagaatcgctcgcatggcagagcaaagcgggataaatctcattctcataccccatct
catagagcagggaggtctcgtagtcctgccactaagaggggacggtctcgatctagaacc
cccaccaagagaggtcactccaggtcccggtcccctcagtggagaaggtcaagatctgca
cagaggtggggaaaatctagaagtccccagaggcgtggccgttcaaggtctcctcagagg
ccaggttggtccaggagcagaaatacccagagaagaggcaggtctaggtcagcaaggcga
ggcagatcacattctagatctccagctactaggggcagatcccgatctagaacaccagct
agaaggggtaggtctcggtccagaacacctgccaggcgaagatcacgatccagaacacct
gccaggcgtaggtctcggtctagaacaccagctcgcaggggcaggtccagatcaagaaca
cccgctcgccgcaggtctaggacacgatcaccagttcgaaggaggtctcggagtagatcc
caagctaggagaagtggtaggtctaggtccagaacaccagccaggagaagtggcaggtca
agatctagaacaccagccaggagagggaggtcccggtctagaacgccagccagaagaagc
gctcgatctcggtctagaacgccagccaggagagggaggtcacgatccagaacaccagca
cgacgacgatctcgaagtagaagtcttgtgagacgtggaagatctcactctagaacacca
caaagaagaggacgatctggctcatcctcagagaggaagaacaaatctagaacatctcag
aggagaagcagatccaactcaagcccagaaatgaaaaaatctcacgtttcctcaagacgg
agcaggtctctttcttcaccacgatccaaagcaaaatctttgaggcgaagcctttcaggt
tcctctccatgtcctaaacaaaagtcacagacaccaaccaggcgaagtcgttctggttct
tcaccacctaaacaaaagtcaaaaacaccaccaagacagagtcgttcaaattctcctcag
cctaaagtaaaatctggaacaccaccaagaccagggtctgtaacaaacatgcaggctgat
gaatgcactgcaacaccacagagacagagccattctgaatcatcacctgatggtgaggtg
aaatcaaggaccccatcaagacaaagctgctctgggtcttctcctcgagtgaaatctagc
acacctccaagacagagcccatctaggtcgtcatctccacaacccaaagtgaagacagtg
atatcaccaagaggaagaagccattctagctcctcttctccaagtcctagtagagtgaca
tctaggacacctcagaggaaaagcagatcaatatctccttgccccaaggtagactctaga
ttaagacatagccgttctagatcctcctcaccagattccaagatggaactgggaacacca
ctgagacactcaggatctacatctccatatctaaaaagcatgctccagactccaccagat
caaaatctttctggatcaaagtcaccctgtccccagaagtctagggattcaccaacagga
agctctggatcttttcacctctgtccaggtgtaacacctagtagtatagtaccaggagag
agctgttttagcgcctcatttgtgcaacaaaaaggacacactcaaacttggccagatact
tcaagtccagaagtcatgcagactcaagtggaatctccattgctgcagagcaaatcccaa
acatctcctaagggtagcctttccagatcttcatctccagtcactgagctgacagccaga
tcaccagtaaaacaagataaaagtgaaatatcaacagatccaaagctgaagtcaggaatg
tctcctgagcagagtaagactaaacctgactctagcatatatcctttagtagactctaaa
tcttttctggtgcagagcagattggagccttctgaattaaaagagagactgggtttaatt
caagaggatgttgcatcatcttgtataccaagagacaaatttagtcctacacaggatagg
cctgagtcttccacagtactgaaagtcacacctagagtactattaaaagaaagaagtgga
gctggctcacctccaggcaaaagagaccaaaaaagtttattacctaattcaagtcaagat
gaactaatggaagtagaaaagtctgagcaacctttaagccaagttctacccagtttatct
ccagaacataaagaaatgcctggaagtaacattgagtcatctcctgaagtagaagaaagg
cctgctgtattgtctgctcttgaccaaagccagtcacagccttcaaaagcagcagaaacc
cctgcagtggcttcatgttggagtgggccacaagtttctccagagcataaagaactatct
cattctcccccaagggagaatagctttgagtcatctttagagtttaaaaactcaggccct
gtttcagaagtaaatactggcttttctcctgaggttaaagaagaattgaatggatcattc
cttaatcaaacagaggcagatccatctgtggacatgaaagaacagtcaaggtcttccagg
cgaagcagttctgagttatccccagaagtagtggaaaaggtaggattattttcaagtcag
aaagtatcttcgcctgtacttgagactgtacaacaaagaacaccttcaagagaaagaagt
agttctgcatctcctgaactgaaagatggtttgcctagaacgccatctaggagaagccgg
tctgggtcttctccaggacttagagatgggtctgggactccttctaggcatagcctatct
gggtcctctcctgggatgaaagatacacctcaaaccccctccaggggacgaagtgaatgt
gactcttctccagaaccaaaagcattgcctcagactcctagagcccgaagtcattctcca
tcatccccagagcgcaacaacaagagtgtcacccctcagagagaaagaagtgggtcagaa
tcatcagtagaacagaaaaatctggctaggacctctccgggacaaagaagtcgatctggg
tcttcccaagagcttgatggaaagcccagcgcgtccccacaggaaagaagtgagtcagac
tcttctccagattccaaacccaagactcggactcctctcagacagaggagtcactctgga
tcatctccagaggttgacagcaaatctcgacactcacccaggctcagtaggtctggctca
tctccggaaatgaaagataagccaagagtgctacagagggctcagagtggtactgattct
tctcctgaacacaagatacctgctcctcgggccctgcccaggcatagtagatcaggttca
tcaagcaaagagagaggtccttcccctgaaggaagcagtagttctgagtcttctccagaa
cacgcccccaaatccagaactgctcgaagaggttccaggtcctcaatagagccaaagaca
aagtctcacacaccacctcgacgccggagctctcgatcatctcctgagctaaccaggaag
gctagagtctctcgtagaagccggtctgcctcctcatcaccagaaatccgctccagaact
ccaccaagacgcagaagaagtccttcagtatcttcaccagagccaactgaaaagtcaagg
tcttcacggaggaggcgctcagtttcttctccccgtaccaagacaacttcgaggagagga
cggtctccttcacccaaacctcgtggactccaaagatcccgatcccgctcacggagagag
aaaaccagaacaacccgacgcagagatagatctggatcatctcagtcaacatctcgaaga
agacagaggagccggtctagatcacgagttactcggagacggaggggtggctctggttac
cattcaagatcacctaccagacaggagagttctcgaacctcctctagacgcagaagaggc
cgctcccggacacccttgaccagtcggaagcgatctcgatcaagaacatcaccagctcct
tggaagcgctctagatctcgagcctcaccagctactcatcggcggtccaggtccagaaca
ccactgataagccgacgtaggtccagatctcggacctcacctgtgagtaggagacggtca
aggtcagtgaataggcgtagatctcgatcaagagcatccccagtgagtcgaaggcgatcc
aggtccagaacaccaccagtaactcgtcgtcgttcaagatccagaacaccaactcgccgt
cgttctcgttctaggactcctccagtgactcgcagaaggtccagatccaggactccacca
gtaaccaggaggcgatctagaagcagaacttcacctgttactagaagaagatcaagatcc
aggacatccccagtcacccggagaagatcgagatctcgaacatctccagtcacccggagg
cggtcccgttcccgaacctctccagtgacaagacgacgctccaggtctcgaactccgcca
gcaattcgaagacgatctaggtctcggacaccactgttgccacgcaagcgctctcgaagc
cgctcaccacttgctatccgccgccgttctaggtctcgtactcctagggcagctcgaggc
aagcggtccttaacaagatctcctccagccattcgtaggcggtctgcatctggaagtagt
tctgatcgttcacgttctgccactcctccagcaacaaggaatcattctggatctcggaca
cctcctgtagcactcagtagctctagaatgagttgctttagccgtcctagcatgtcacca
actcctcttgaccgatgtagatcacctggaatgcttgaaccccttggaagcgctagaacg
cccatgtctgtgctacagcaaacaggtggctccatgatggatggtccaggtcctcggatt
cctgatcacccaagatcatctgttccagaaaaccatgctcagtctagaattgcacttgcc
ttgacagccatcagtcttggtactgcccggccacctccatccatgtctgctgctggcctt
gctgcaagaatgtcccaggttccagcacctgtacctctcatgagccttagaacagcccca
gctgctaaccttgccagcaggattccagcagcatctgcagcagctatgaaccttgctagt
gccaggacatctgctattccggcatctgtgaaccttgctgactcaagaacaccagctgct
gctgcagctatgaacttagccagccctagaacagcagtggctccttcagctgtgaacctt
gcagatcctcgaacccctgcagcttcagctgtgaacctagcaggagctagaacaccagct
gcattagcagctttgagtctcacaggctctgggacacctccaactgctgcaaattacccc
tccagttccagaacaccccaggctccaacccccgcaaacctggtggtgggtcctcgatct
gcgcatggcacagctcctgtgaatattgctggctctagaacccctgcaggcttggctccc
acaaatctctccagttccaggatggctccagcattgtctggtgcaaacctcaccagtccc
agggtgcccctttctgcttatgatcgtgttagtggcagaacctcacctttaatgcttgat
cgagccaggtccagaacaccaccatctgccccaagccagtctagaatgacctctgagcgt
gagcgggctccttcccctgcttcaagaatggttcaggcttcttcgcaatctcttctccct
cctgcacaggatcggcctcggtcccctgtgccatctgctttttcagaccaatctcgttca
gttgtccagaccactcctgtagcagggtctcagtccctttcatccgggacagtagcgaag
tccacatcctctgctagtgaccacaatggcatgctttctggccctgcccctgggatatcc
catgctgaaggtggggagccacctgcctctactggggcccagcagccttctacattggct
gctctgcaaccagctaaggaacgtcggagctcttcctcctcttcatcatcatctagctcc
tcctcctcttcatcatcttcatcgtcatcctcctcttcctctggctccagttctagtgat
tcagagggttccagccttccagctcaacctgaggtggcactgaaaagggttcccagcccc
accccagtcccaaaggaggctattagagagggacgtcctcaggaaccaaccccggccaaa
aggaagaggcgctctagcagctccagttccagctcctcctcctcctcctcttcctcttct
tcctcttcctcctcctcctcatcttcctcctcctcttcttcctcttcttcctcctcttct
tcctcctcttcctcctccccctcccctgctaagcctggccctcaggcattacccaaacct
gcaagccccaagaagccaccccctggcgagaggaggtctcgaagtcctcggaagccaata
gactcccttcgggattcccgatccctcagttactcacccgttgagcgtcgacagccctcg
ccccaaccttcaccaagggatctacagagcagtgagcgagtttcctggagaggccagcga
ggggacagtcactctcctggtcacaagaggaaggagacacctagtccccgttctaatcgt
caccgctcctccaggtctccataa

DBGET integrated database retrieval system