KEGG   Mus musculus (house mouse): 75964
Entry
75964             CDS       T01002                                 
Symbol
Trappc8, 5033403J15Rik, AI845423, D030074E01Rik, Trs85, mKIAA1012
Name
(RefSeq) trafficking protein particle complex 8
  KO
K20305  trafficking protein particle complex subunit 8
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    75964 (Trappc8)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Tethering complex
   TRAPP complex II
    75964 (Trappc8)
SSDB
Motif
Pfam: TRAPPC-Trs85 SNAP
Other DBs
NCBI-GeneID: 75964
NCBI-ProteinID: NP_001348117
MGI: 2443008
Ensembl: ENSMUSG00000033382
Position
18:complement(20950268..21033851)
AA seq 1422 aa
MAQCVQSVQELIPDSFVPCVAALCSDEAERLTRLNHLSFSELLKPFSRLTSEVHMRDPNN
QLHIIKNLKIAVSNIVTQPPQPGAIGKLLNDVVSGSQPAEGLVANVITAGDYDLNISATT
PWFESYRETFLQSMPASDHEFLNHYLACMLVASSGEAEPMEQFSKLSQEQHRIQHNNDYS
YPKWFIPNTLKYYVLLHDVTSGDEQRAESIYEEMKQKYGTQGCYLLKINSRAPNRASDEQ
IPDPWSQYLQKNSIQNQESYEDGPCTMTSSKNSDSNLLSLDGLDNEVKDQCGDPPNNTDG
SESKSASSVHETKKASTAVIRGACLTLTDHDRIRQFIQEFTFRGLLPHIEKTIRQLNDQL
ISRKGLSRSLFSATKKWFSGSKVPEKSINELKNTSGLLYPPEAPELQIRKMADLCFLVQH
YDLAYSCYHTAKKDFLNDQAMLYAAGALEMAAVSAFLQPGAPRPYPAHYMDTAIQTYRDI
CKNMVLAERCVLLSAEILKSQSKYSEAAALLIRLTSEDSDLRSALLLEQAAHCFINMKSP
MVRKYAFHMILAGHRFSKAGQKKHALRCYCQAMQVYKGKGWSLAEDHINFTIGRQSYTLR
QLDNAVSAFRHILINESKQSAAQQGAFLREYLYVYKNVNQLSPDGPLPQLPLPYINSSAT
RVFFGHDRRPADGEKQAATHISLDQEYDSESSQQWRELEEHVVAVANKGVIPSSFYPTQY
CLNSYSDNSRFPLAVVEEPITVEVAFRNPLKVPLLLSDLSLLWKFQPKDASGKDIEKVKE
RVTGEPEMIGTEVISEFLINSEESKVARLKLFPHHIGELHILGVVYNLGTIQGSGTVDGI
GALPGCHTGKHSLSMSVRGRQDLEIQGPRLNNTKEEKTSVKYGPDRRLDPIVTEEMPLLE
VFFIHFPTGLLCGEIRKAYVEFVNVSKCPLTGLKVVSKRPEFFTFGGNTAALTPLSPSTS
ENCSAYKTVVTASPSLGTALVSTASSMDFGTGTGQQLEAIPVPLPDSVLLPGASIQLPMW
LRGPDEEGVHEINFLFYYESVKKQPKKRHRILRHTAVICTSRSLNVRATVCRSNSLEDEE
GRGGNMLVFVDVENTNTSEAGVKEFHMVQVSSSSKHWQLHKSVNISENKDAKLASREKGK
FCFKAVRCKQKEGGIQSSEKYTFADIIFGNEQIISSASPCADFFYRSLSSELKKTQDQLS
AYPEKHREATEGAVRLVEKCSEVDLSIVILWKAYVVEDNKQLILEGQHHVVVRTVGKEAF
SHSQKEEPPEMELLKFFRPENTTVSTRPSVEQLSNLIKTSLHYPESFHHPFHQKSLCLVP
VTLLLSNCSKADVDVIVDLRHKTTSPEALETHGSFTWLGQTQYKLQLKSQEMHSLQLKAC
FVHTGVYNLGTPRVFAKLSDHVTVFETSQQNSMPALIIINNA
NT seq 4269 nt   +upstreamnt  +downstreamnt
atggcccagtgcgtgcagtcggtgcaggagctcatccccgactccttcgtcccctgcgtc
gccgcgctgtgcagcgacgaagccgagcggctcacccgcctcaaccacctcagcttctcc
gagctgctcaagcccttctctcgcctcacttccgaagttcacatgagagatcctaataat
caactgcatataattaaaaatttgaagatagcagtaagcaacattgtcacccagccacct
cagccgggagccattgggaagcttttgaatgatgttgtttctggcagccagcctgcagaa
ggattagtcgctaatgtgattacagcaggagattatgaccttaacataagtgctactact
ccatggtttgagtcttacagagagacctttctgcagtccatgccagcatcagatcatgag
tttctgaatcactatttagcatgtatgctggtggcatcgtctggtgaagctgagcctatg
gaacagttttcaaagttgtcacaggaacagcatcgaattcagcacaacaatgattattcc
tatcctaagtggtttatcccaaatacacttaaatattacgtgcttttgcatgatgtaact
tcaggagatgaacaaagggctgaatcaatttatgaagaaatgaaacagaaatatggaact
cagggttgctatttacttaaaatcaattctcgagcaccaaatcgagcatcagatgaacag
ataccagatccgtggagtcagtatctccagaaaaatagtattcaaaaccaggaatcatat
gaagatggcccttgtactatgacctccagtaagaattctgatagtaacttgctttcattg
gatggactagataacgaagtcaaagaccaatgcggtgaccctcctaacaatactgacggc
tcagagtcaaagtctgcttcttcagttcacgagacaaagaaagcaagtactgcagtgatt
cgtggtgcttgcttaacactcactgaccatgatagaatccgacagtttatacaagagttt
acattccgtggccttttgccacacatagagaaaacaattcgtcagttaaatgatcagcta
atatcaaggaaaggtttgagtcgatctctgttttctgccactaagaaatggtttagtggt
agtaaagttccagaaaagagcattaatgagctgaagaatacatctgggttgttgtatccg
ccagaagcgcccgagcttcagatcaggaagatggctgacttgtgcttcttggtgcaacat
tatgatttggcttacagttgttatcacactgcaaagaaggattttcttaacgatcaagca
atgctttatgcagcaggtgccttggaaatggcagcagtgtcagcctttcttcagccagga
gctcctaggccataccctgctcattacatggacacagcaattcagacatacagggatatc
tgcaagaatatggtgttggctgaaagatgtgtgttgcttagtgctgaaattttaaaaagt
caaagcaagtactcagaggctgcagctcttctgatacgattgacaagtgaggattctgat
ctccgaagtgcccttcttttggaacaggctgcacattgcttcataaacatgaagagtccc
atggttagaaaatacgcatttcatatgatcctggcaggccaccgttttagtaaagcaggg
cagaaaaagcatgctttgcgctgctattgtcaagccatgcaagtttacaaaggaaagggc
tggtctctggcagaggatcacatcaacttcaccattgggcgccagtcctatactctgagg
cagctggacaatgctgtttctgcttttagacacattttaatcaatgaaagcaaacagtct
gctgctcagcaaggagccttcctcagagaatatctttatgtttataagaatgtaaatcag
ctgtcaccagatggccctttaccacagcttcccttaccatacattaacagttcagcaaca
cgggttttcttcggccatgacagacgaccagcagatggtgaaaagcaagcggctactcat
ataagtcttgatcaagaatatgactctgagtcatcccagcagtggcgggaacttgaggaa
catgttgtggctgtggctaataaaggagtaattccatccagtttctatcctacacagtat
tgtctgaacagttactccgataactccaggtttccacttgcagttgtagaagagccaatt
actgtggaagtggcttttagaaaccctttaaaagttccgcttttgctgtctgatttgtca
ttactctggaagtttcagcctaaagatgccagtgggaaagacattgaaaaagtgaaagaa
cgagttacaggtgaacctgaaatgattggaactgaagttatttcagaattcttaattaac
agtgaagaatctaaagtggcaagactgaagctctttccccatcacataggggagctgcac
attctgggagttgtgtataatcttggcactattcagggctccgggacagtagatggcatt
ggtgctcttcctggatgtcacacaggaaaacattctctgagtatgtcagtacgagggaga
caggatttagaaattcaaggccctcgacttaacaacacaaaggaagagaagacatctgta
aagtacggtcctgaccgacgtttagatcctatagtcacagaggagatgccgctgctggag
gtgttctttatacattttcctacagggctcctctgtggagaaatccgaaaagcatatgta
gagtttgtcaatgtcagcaaatgtcctctgactggactgaaagttgtgtctaaacgtcca
gagttcttcacttttggtggcaataccgctgctctaacaccactgagcccctccacatct
gagaactgcagtgcctataagacggttgtaacagcttccccctccttgggaacagcactt
gtgtcaacagcatcatctatggactttggaactggcaccggacagcagctggaggccatt
cctgtcccccttcctgactccgtgctgctccccggagcttccatccagctgccaatgtgg
cttcgtgggccagacgaagagggtgtccatgaaattaactttttattttactatgaaagt
gttaaaaagcagcctaaaaaacgacacagaatattaagacacactgcagttatttgtact
agccggtctttgaatgtgcgagcgactgtctgcagaagtaattcacttgaagatgaagaa
ggcaggggcggcaatatgctagtcttcgtggatgtagaaaatactaatactagtgaagcg
ggggttaaggagttccacatggtgcaggtgtcaagcagtagcaagcactggcagctacac
aagtccgtgaatatctccgaaaacaaagatgccaagcttgccagtagggagaagggaaag
ttttgcttcaaggcagtaagatgtaaacaaaaagaaggtggtatacagtcctcagaaaaa
tacacctttgcagatatcatctttggaaatgaacagataataagttcagcaagtccgtgt
gcagatttcttttaccgaagtttatcctcagagttgaagaaaacacaggatcagctttct
gcgtatccagagaaacacagagaagccacagagggtgctgtgaggctggttgagaagtgc
agtgaggtggacctgagcatcgtcatcctatggaaggcatacgttgtagaagataacaag
cagcttattttagaaggccagcatcacgttgttgttcgcactgttgggaaagaagccttt
tcacactctcagaaagaggagccaccagaaatggaactattaaagtttttcaggccagaa
aacactacagtttccacaagaccatcagtagagcagctttctaatctcattaaaacaagt
ctccactatccggagtcatttcaccatccatttcatcagaaaagcctttgcttagtccca
gtcacccttttactttctaactgttctaaggctgatgtagacgtaatagttgatctccgg
cataaaacaacaagtcctgaggcactggaaactcacggatcattcacgtggcttggacag
acacagtataagctccagctgaaaagccaagagatgcacagtttgcagctgaaggcatgc
tttgttcatacaggcgtttataaccttggaactccaagagtattcgccaagttatcggac
cacgttacagtatttgaaacaagtcagcagaactccatgcctgctctgattatcatcaat
aacgcgtga

DBGET integrated database retrieval system