KEGG   Mus musculus (house mouse): 75985
Entry
75985             CDS       T01002                                 
Symbol
Rab30, 5033421K01Rik, AI323892, Rsb30
Name
(RefSeq) RAB30, member RAS oncogene family
  KO
K07917  Ras-related protein Rab-30
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    75985 (Rab30)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab19/30/43 [OT]
    75985 (Rab30)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 GTP_EFTU ATP_bind_1 RsgA_GTPase FeoB_N AAA PduV-EutP SRPRB AAA_33 AAA_5 TsaE AAA_16 NACHT AAA_22 NTPase_1 TIR_2 Mg_chelatase ABC_tran AAA_7 AAA_24
Other DBs
NCBI-GeneID: 75985
NCBI-ProteinID: NP_083770
MGI: 1923235
Ensembl: ENSMUSG00000030643
UniProt: Q923S9 Q0PD24
Position
7:92390845..92493743
AA seq 203 aa
MSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKL
QIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLV
GNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQNTLV
NNVSSPLPGEGKSISYLTCCNFN
NT seq 612 nt   +upstreamnt  +downstreamnt
atgagtatggaagattatgatttcctgttcaaaattgttttaattggcaacgctggagtg
ggaaagacgtgcctagtccgaagattcactcagggtcttttccccccaggtcaaggagcc
acaattggagttgattttatgattaagacagtggagattaatggtgaaaaagtgaagtta
cagatctgggacaccgcaggtcaagagagatttcgctccatcactcaaagttactatcga
agcgccaatgccttgatccttacctatgacatcacctgtgaggaatccttccgctgcctt
cctgagtggttgcgggagatagaacagtatgctagcaataaagtcatcactgtgttagta
ggcaacaagattgacctggctgaaaggcgagaggtctcccagcagagagcagaagagttc
tcagaggctcaggacatgtattacctggagacttcagccaaggaatccgacaatgtggag
aaactcttccttgacttagcatgccgactcatcagcgaagcaagacagaacacactggtg
aacaatgtatcgtcacccttacccggagaggggaaaagcatcagctatttgacttgttgt
aatttcaactaa

DBGET integrated database retrieval system