KEGG   Mus musculus (mouse): 75991Help
Entry
75991             CDS       T01002                                 

Gene name
Slain2, 5033405K12Rik, 8030444K12Rik, AI596370
Definition
(RefSeq) SLAIN motif family, member 2
  KO
K16580  SLAIN motif-containing protein 1/2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    75991 (Slain2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    75991 (Slain2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Microtubule-associated proteins
     75991 (Slain2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Cytoplasmic linker proteins (CLIPs)
     CLIP-associating proteins
      75991 (Slain2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SLAIN GIT_CC bZIP_1
Motif
Other DBs
NCBI-GeneID: 75991
NCBI-ProteinID: NP_001106894
MGI: 1923241
Ensembl: ENSMUSG00000036087
Vega: OTTMUSG00000033878
UniProt: Q8CI08
Position
5; 5 C3.2
AA seq 581 aa AA seqDB search
MEDVNSNVNADQEVRKLQELVKKLEKQNEQLRSRSGAVQGAGLLGPGSPARVGVSTPSSG
AASPRGFPLGLGAKASGGAGSGPRRTSSEDLRDATSLLAAGEGGLLDEVEPLRPDELERL
SGWEEEEESWLYSSPKKKLTPMQKSVSPLVWCRQVLDYPSPDVECAKKSLIHKLDQTMSA
LKRQNLYNNPFNSVSYSNSYSPNASSPYSSGFNSPSSTPVRPPIVKQLILPGNSGNFKSS
SDRNPPLSPQSSIDSELSASELDEDSIGSNYKLNDVTDVQILARMQEESLRQEYAASTSR
RSSGSSCNSTRRGTFSDQELDAQSLDDEDDSLQHAVHPALNRFSPSPRNSPRPSPKQSPR
NSPRSRSPARGIEYSRASPQPMISRLQQPRLSLQGHPTDLQTSNVKNEEKLRRSLPNLSR
TSSTQVDSVKSSRSDSNFQVPNGGIPRMQPQASAIPSPGKFRSPAAPSPLALRQPVKAFS
NHGSGSGSQETTQFTQTTSSPGPPVVQNSAPANPSSNINSATLTRPAGTTAMRSGLPRPS
APSAGGIPVPRSKLVQPVRRSLPAPKSYGSMKDDSWKDGCY
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgttaactccaatgtgaacgcggaccaggaggtgcggaagctgcaggagctg
gtgaagaagctggagaagcagaacgagcagctgaggagccgctcgggagccgtgcagggt
gcaggcctcctcgggcccggcagcccagctcgggtcggcgtgtccaccccttcgtcgggc
gcggcgtcccctcggggcttcccgctgggcctgggcgccaaggccagcggcggggcgggc
tccggcccgcgacggaccagcagcgaggacctgcgggacgccacctccttgctggcggcc
ggcgagggaggcttgctggacgaggtagagccgctgcggcccgacgagctggagcgcttg
tcaggctgggaggaggaagaggagagctggttgtactcatcaccaaagaaaaaactcaca
ccaatgcagaaatctgtcagtccattagtttggtgcaggcaagttttggattacccaagt
cctgatgtggagtgtgctaaaaagtcccttatccacaaacttgatcaaactatgtcagct
ctcaagaggcaaaatttatacaataatcctttcaactctgtgagttactcaaattcttat
agtccaaatgccagtagcccatacagcagtggcttcaactctccatcctcaacaccagtg
cgacctcccatagtcaagcagcttatacttcctggaaattcaggtaacttcaaaagttca
tcagatagaaaccctccactcagccctcagtcctctatagatagtgagttaagtgcttca
gaattagatgaagattcaattggatccaactataagctaaatgatgtaactgatgtgcag
attctagcgcggatgcaggaagaaagtctccggcaagaatatgcagccagcacctctcgc
cgcagctctggttcatcttgcaattctacgaggcggggcacttttagtgatcaggagctg
gacgcccagagcttggatgatgaagatgacagtctgcagcatgcagtacaccctgccctt
aataggttttctccatccccacggaattcaccacgaccatctcctaagcagtcgcctcga
aattcacctcgttcacggtctcctgcccggggaatagaatacagtagagcgtccccacag
cctatgattagccgcttgcagcagcctcgcctttccctccaaggccatcccacagattta
cagacgagcaatgttaaaaatgaagaaaaacttagacgcagtcttccaaacctatcccga
acatcgagcacacaggttgactctgtgaaaagcagtagaagtgactccaattttcaagtg
ccaaatggaggaatacctcgaatgcagcctcaggcttcagccataccttctccaggcaaa
ttccgctcccctgcagcaccgtctccattggctcttcggcaaccagtgaaagcgtttagt
aaccatggctctggttctggtagccaagaaactacccagttcacacaaaccacctcctca
cctgggcctcctgtggtgcagaactcagccccagcaaacccttccagcaatatcaacagt
gccactctaaccagacctgcagggacaactgcaatgaggagtggcctgccccggccaagc
gccccttctgcggggggcatcccagtgcctcgcagcaagcttgtacagcctgttcgaaga
tcattgccagctcctaaaagttatggtagcatgaaagatgacagttggaaagacggctgt
tactga

DBGET integrated database retrieval system