KEGG   Mus musculus (house mouse): 76007
Entry
76007             CDS       T01002                                 
Symbol
Zmym2, 5830413P05Rik, FIM, MYM, RAMP, SCLL, Zfp198, Znf198
Name
(RefSeq) zinc finger, MYM-type 2
  KO
K24675  zinc finger MYM-type protein 2/3/4
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    76007 (Zmym2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    BRAF-HDAC complex
     76007 (Zmym2)
SSDB
Motif
Pfam: zf-FCS DUF3504 Arc_trans_TRASH YHS
Other DBs
NCBI-GeneID: 76007
NCBI-ProteinID: NP_083774
MGI: 1923257
Ensembl: ENSMUSG00000021945
UniProt: Q9CU65
Position
14:57123986..57199815
AA seq 1376 aa
MDTSSVGTLELTDQTPVLLGSTAMATSLTNVGNSFSGPPNPLVSRSSKFQNSSVEDDDDV
VFIEPVQPPPSSAPLVADQRPITFTSSKNEELQGNDPKILPSSKELAPQKGSVSETIVID
DEEDMETNQGQEKSSSNFIERRPSETKNRTNDVDFSSSTFSRSKVNAGVSNSGITTEPDS
EIQIANVTTLETGVSSVSDGQLESTDGRDMNLMITHVTSLHNTSLGDGSNGLQSSNFGVN
IQTYTPSLTSQTKAGVGPFNPGRMNVAGDVFQNGESAPHHNPDSWISQSASFPRNQKQQG
VDSLSPVASLPKQIFQPSNQQPTKPVKVTCANCKKPLQKGQTAYQRKGSAHLFCSTTCLS
SFSHKPAPKKLCVMCKKDITTMKGTIVAQVDSSESFQEFCSTSCLSLYEDKQSPAKGALN
KSRCTICGKLTEIRHEVSFKNMTHKLCSDHCFNRYRMANGLIMNCCEQCGEYLPSKGAGN
NVLVVDGQQKRFCCQSCVTEYKQVGSHPSFLKEVRDHMQDSFLMQPEKYGKLTTCTGCRT
QCRFFDMTQCIGPNGYMEPYCSTACMNSHKTKYAKSQSLGIICHFCKRNSLPQYQATMPD
GKLYNFCNSSCVAKFQALSMQSSPNGQFVAPSDIQLKCNYCKNSFCSKPEILEWENKVHQ
FCSKTCSDDYKKLHCIVTYCEYCQEEKTLHETVNFSGVKRPFCSEGCKLLYKQDFARRLG
LRCVTCNYCSQLCKKGATKELDGVVRDFCSEDCCKKFQEWYYKAARCDCCKSQGTLKERV
QWRGEMKHFCDQHCLLRFYCQQNEPNMTTQKGPENLHYDQGCQTSRTKMTGSAPPPSPTP
NKEMKNKAILCKPLTMTKATYCKPHMQTKSCQTDENWKTEYVPVPIPVPVYVPVPMHMYS
QNIPVPTTVPVPVPVPVFLPAPLDSSEKIPATVEDLKSKVSSDPLDSELLTMTDMMTEEE
GKAEASNINSVIIETDIIGSDLTKNSDPDIQSNMPDVPYEPDLDIEIDFPRAAEELDMEN
EFLLPPVFGEEYEEQPRPRSKKKGTKRKAVSGYQSHDDSSDNSECSFPFKYTYGVNAWKH
WVKTRQLDEDLLVLDELKSSKSVKLKEDLLSHTTAELNYGLAHFVNEIRRPNGENYAPDS
IYYLCLGIQEYLCGSNRKDNIFIDPGYQMFEQELNKILRSWQPSILPDGSIFSRVEEDYL
WRIKQLGSHSPVALLNTLFYFNTKYFGLKTVEQHLRLSFGTVFRHWKKNPLTMENKACLR
YQVSSLCGTDNEDKIATGKRKHEDDEPVFEQVENTANPSRCPVKMFECYLSKSPQNLNQR
MDVFYLQPECSSSTDSPVWYTSTSLDRNTLENMLVRVLLVKDIYDKDNYELDEDTD
NT seq 4131 nt   +upstreamnt  +downstreamnt
atggacacaagttcagtgggaacgttagaactgactgatcaaactcctgtcttattagga
agtacagccatggcaactagtctcacgaacgtaggaaattcatttagtggcccacctaat
cctttagtgtctagatctagtaagtttcagaactcatcagtagaagatgatgatgacgtt
gtttttattgaacctgtacaacctcctccatcttctgcacctttggttgctgatcaaaga
cccataacatttacatcttcaaaaaatgaagaactacaaggaaacgatcccaaaattctt
ccttcatcgaaagagttggccccgcaaaagggcagtgtaagcgagacaattgttattgat
gatgaagaggacatggaaacaaatcaaggacaagagaagagttcctcaaattttattgaa
aggagaccttctgaaactaaaaacagaactaatgatgtggatttctccagttccactttt
tcaagaagtaaagtaaacgcaggagtgagtaacagtggtattaccacagagccagactcg
gagattcagattgctaatgttacaaccttagaaacaggcgtaagctctgtgagtgatggc
cagctagaaagtactgatgggagagatatgaacttaatgattactcatgtcacatcactg
cacaacaccagcctgggagatggctccaacggacttcagtccagtaactttggtgtgaat
atacaaacgtacaccccatctctaacgtcacagaccaaggctggagttggaccttttaat
cctggtaggatgaatgttgcaggagatgtatttcagaatggagagtctgcacctcatcac
aatcctgattcttggatctcccagtcagcatcatttcctcgtaaccagaaacaacaaggg
gtggattctttatcaccagtggcctcacttcctaaacagatattccagccctcgaaccaa
caacccactaaaccagttaaagtcacttgtgcaaactgcaaaaaacctctacagaagggg
cagacagcttaccaacgcaaaggatcagctcacctcttctgttcaaccacctgcctttct
tctttctcccataagcctgctccaaagaaactctgtgttatgtgtaaaaaagatataact
acaatgaagggaaccattgttgctcaagtggactcaagtgagtccttccaagaattttgt
agtacatcttgtttgtctctctatgaggacaaacagagtcctgctaaaggagctctaaat
aaatcaagatgcacaatctgtggcaaattaactgagattcgccatgaagttagttttaaa
aacatgactcataagctgtgcagtgaccactgctttaacagataccgaatggccaatggt
ctgataatgaattgctgtgagcagtgcggagaatatttgcccagtaaaggtgctgggaat
aatgttctggtggttgatggtcagcagaagagattttgttgtcagagttgtgtcactgaa
tacaaacaggtaggtagccatccaagcttcctgaaggaagttcgggatcacatgcaggac
tctttcttaatgcagcctgagaaatatggaaaactgacaacttgtactggttgccgaaca
cagtgcaggttttttgatatgactcagtgcataggtcctaatggatatatggagccatat
tgttcaactgcttgcatgaacagtcacaagacaaaatatgcaaaatcacaaagtttggga
attatttgccatttttgtaagcgaaactctttacctcaataccaagccacaatgcctgat
ggaaaactgtataacttttgcaattccagttgtgtggctaaatttcaggctctaagcatg
cagtcatctccaaatggccagtttgtagcacccagtgatattcagctgaaatgcaactac
tgtaaaaattccttttgttcaaaaccagaaatcttggaatgggagaacaaagtgcatcag
ttctgcagcaaaacttgctcagatgactataagaagttgcattgcatagttacatattgc
gaatactgccaagaggagaagactctgcatgaaacagtaaatttctctggcgttaagaga
cctttctgtagtgaaggctgcaagctattatacaaacaagattttgcaagacgattagga
ttaagatgtgttacctgcaactattgttctcagctgtgtaagaagggagccactaaagaa
cttgatggagttgtcagagacttctgcagtgaagactgctgtaagaaattccaggagtgg
tactacaaggctgcgaggtgtgactgctgtaaatcccaaggcactctgaaagagcgagtg
cagtggcgtggcgaaatgaaacatttctgtgatcagcactgcttactacgtttctattgt
cagcaaaatgagcccaacatgacaactcagaaaggacctgaaaacctacattatgatcag
ggctgtcagacgtcccgaaccaaaatgacaggctcagcaccacccccttctcctacacca
aacaaagagatgaagaataaagcaattctttgcaaacctttaacaatgacaaaagcaact
tactgtaagcctcacatgcagaccaaatcttgtcagacagatgagaattggaagacagag
tatgtcccagtgcctattcctgtccctgtgtatgtccctgtgcctatgcacatgtacagc
cagaatattcctgttccgaccacagttcctgttcctgtgcccgttcctgtgtttctgcct
gctccattggacagcagtgagaagattcctgccacagttgaggacctcaaaagcaaagtt
tcttcagatcctcttgattcagaattgcttacgatgacagatatgatgactgaagaggag
gggaaagcagaggcatccaacatcaatagtgtaattattgagacagacataattggctca
gatcttacaaagaactctgacccagatatacaatccaacatgcccgatgtaccatatgaa
ccagatttggatattgaaatagatttccccagagctgcagaggagcttgatatggaaaat
gagtttttattaccacctgtttttggagaagaatacgaggagcagcccagacctcgatct
aaaaaaaagggaaccaagaggaaggctgtatcaggataccagtctcatgatgatagttct
gacaattcagaatgcagctttcctttcaagtatacatacggtgtaaatgcgtggaaacat
tgggtcaaaactaggcaacttgatgaagatcttctggtattagatgagctaaaatcctct
aaatcagtaaagttaaaagaagatctactctctcataccacagctgagcttaactatggg
ttagcccattttgtcaatgagatcagacgaccaaatggagagaattatgcacctgacagc
atctattatctatgccttggtatacaggagtacttatgtggtagtaatcgaaaggacaac
atatttattgatccaggataccagatgtttgagcaagaactgaataaaatactccgaagt
tggcaaccaagcatacttccagatgggtcaattttctctcgagttgaagaagactatctc
tggaggataaaacaactaggatcccactctccagtagcacttttgaataccctattctac
tttaacactaagtattttggcctgaaaacagtggaacaacacttaagactttcctttggc
actgtgtttaggcattggaaaaaaaatcctttaacaatggaaaataaagcatgtcttcgc
tatcaggtgtcttccttatgtggaacagacaatgaagataaaattgctactggaaaacga
aaacatgaagatgatgagccagtatttgaacaagttgaaaacacagccaacccttctaga
tgtcctgtgaaaatgtttgaatgctacttgtctaaaagtccacagaaccttaatcagaga
atggatgttttttatttacaaccagaatgttctagttctacagatagccctgtctggtac
acatctacttccctggaccggaacaccttggaaaatatgcttgtacgggttcttctagta
aaagatatttatgataaagacaattatgaactggatgaagacacagactaa

DBGET integrated database retrieval system