KEGG   Mus musculus (mouse): 76041
Entry
76041             CDS       T01002                                 

Symbol
Ccdc125, 5830436D01Rik, AL023012
Name
(RefSeq) coiled-coil domain containing 125
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF2353 NAPRTase_N DUF2552 BORCS8
Other DBs
NCBI-GeneID: 76041
NCBI-ProteinID: NP_898938
MGI: 1923291
Ensembl: ENSMUSG00000048924
UniProt: Q5U465
Position
13; 13 D1
AA seq 500 aa
MSKVPRSSSEAEDIWETEDDMTEGDLGYGLGRKPGGIYEVPCSITSKKRSDGKNSSPPPF
PRKGEERSETSFQYSRRKGFQDTSAEGYRASRLSSTDSNSELSDEQLRRRLHEALEDVEI
LKTELEASQRQLEGKEEALKILQSMAMLGKATSHTQTMLQKTIEQKRSLEKEINALQWEM
EFDQDRFKNIEESWIQKCDRLNCDNAVLRENLKLRTEEIKMLKSKNAVLNQRYLEALAML
DIKEQKMGQEESGFTDVSGLELAVLGACLCHGPGGSPCSCAKMAASTRKLVLQLRHELET
LQKSKEEAHITADAFRIAFEQQLMRKNEQALRLAGGDLCKRAATWINRQHQADDGYPAQR
RKKTLGQRLLGILPSENSSKGAEDQDNMQEVFKMLVDLLNDKEEALAHQRKVSYMLARAL
EDKDTASERNKEKIPMSQTFPFKTAWHDASELCGLRDPVQSNHVSEPMACICSIQHPPKV
SDCPRTLKRSCSLPSTLFYK
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgagcaaagtgccgaggtcatcgagcgaggcagaggacatctgggaaacagaggatgac
atgaccgaaggtgacctaggctatggcctcggaagaaaacccggtggtatttatgaagtt
ccgtgttcgattacatctaagaaaaggtcagatggaaagaactcaagccctcctccgttt
ccaagaaagggagaagaaagaagcgaaaccagtttccagtattccaggaggaagggcttt
caagatacaagcgctgagggataccgagcatccagactgagcagcacagattctaactca
gaattgtcggatgagcagttaaggcgacgtcttcatgaagccttagaggacgtagagatt
ttaaaaacggaacttgaagcgtctcaaagacaacttgaaggtaaagaggaagcattgaaa
atcctccaaagcatggcaatgcttggcaaagccacaagccacacacagacaatgcttcaa
aaaactatagaacaaaagagatctctggagaaggaaataaatgccttgcagtgggaaatg
gaatttgatcaggatagatttaaaaatatagaagaatcttggatccagaaatgtgacagg
ctaaactgtgacaatgcagtcctcagagagaatctgaagttgagaacagaggaaataaag
atgctaaagtctaagaatgctgttttgaatcagcggtacttggaggccctcgccatgctt
gatatcaaggagcagaagatgggtcaggaggagagtggctttacagatgtatcaggtctc
gagcttgcagtccttggagcctgcctgtgtcatggtcctggagggagcccctgttcttgt
gccaaaatggcagcatccactcggaaactggttcttcagctcagacatgagttggaaact
ctgcagaagagtaaggaagaggcgcacataacggcagatgcattcaggattgcttttgag
caacagttaatgaggaaaaatgagcaggcactgagactggctggaggggacctgtgtaaa
agagcggcaacgtggatcaacagacaacaccaggcagacgatggatatccggcacaaagg
agaaagaagaccttagggcaaagattactggggatactcccttcggaaaacagctccaag
ggcgctgaagaccaagacaatatgcaagaggtctttaagatgctggtagatttgttgaat
gacaaagaagaagcccttgcacatcagagaaaggttagttacatgctcgctcgggcgctg
gaagacaaagacacggcctcagaaaggaataaagaaaaaatccccatgagccagaccttc
ccattcaaaacggcctggcacgacgcttcagagctctgtggtctgcgtgatccagtacag
tcaaaccatgtttctgaacccatggcttgcatctgttcaatacagcatcctccaaaagtt
tcagactgcccaagaactcttaaaagatcctgttctttgccatcaactttattttacaag
taa

DBGET integrated database retrieval system