KEGG   Mus musculus (mouse): 76071
Entry
76071             CDS       T01002                                 

Gene name
Jakmip1, 5830437M04Rik, C330021K24Rik, Gaba, Gababrbp, Mar, Marlin-1
Definition
(RefSeq) janus kinase and microtubule interacting protein 1
  KO
K24783  janus kinase and microtubule-interacting protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    76071 (Jakmip1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  JAKMIP domain-containing proteins
   76071 (Jakmip1)
Motif
Pfam: JAKMIP_CC3 DUF5082
Other DBs
NCBI-GeneID: 76071
NCBI-ProteinID: NP_848481
MGI: 1923321
Ensembl: ENSMUSG00000063646
Vega: OTTMUSG00000026769
UniProt: Q8BVL9
Position
5; 5 B3
AA seq 626 aa
MSKKGRSKGDKPEAETDSVQMANEELRAKLTNIQIEFQQEKSKVGKLRERLQEAKLEREQ
EQRRHTAYISELKAKLHEEKTKELQALREALIRQHEQEAARTAKIKEGELQRLQATLNVL
RDGAADKVKTALLADAREEARRTFDGERQRLQQEILELKAARKQAEEALSNCMQADKAKA
ADLRAAYQAHQDEVHRIKRECERDIRRLMDEIKGKERVILALEKELGVQTGQTQRLLLQK
EALDEQLVQVKEAERHHSSPKRELPPGIGDMAELMGGQDQHMDERDVRRFQLKIAELNSV
IRKLEDRNTLLADERNELLKRSRETEVQLKPLVEKNKRMNKKNEELLHSIQRMEEKLKSL
TRENVEMKEKLSAQASLKRHTSLNDLSLTRDEQEIEFLRLQVLEQQHVIDDLSLERERLL
RSKRHRGKSLKPPKKHVVETFFGFDEESVDSETLSETSYNTDRTDRTPATPEEDLDETTT
REEADLRFCQLTREYQALQRAYALLQEQVGGTLDAEREARTREQLQADLLRCQAKIEDLE
KLLVEKGQDAAWVEEKQVLMRTNQDLLEKIYRLEMEENQLKSEMQDAKDQNELLEFRVLE
LEVRDSICCKLSNGADILFEPKLKFM
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgtctaaaaagggccgcagcaagggggacaagcccgaggcggagacggactctgtgcag
atggctaatgaagagctgcgcgccaagctgaccaacatccagattgagttccagcaggag
aagagcaaggtggggaagctgcgggagcgtctgcaggaggccaagctggagcgcgagcag
gagcagcgtcgccacaccgcctacatctcggaactcaaggccaagctgcacgaggagaag
acgaaggaactgcaggcgctgcgcgaggcgctcatccggcagcacgagcaggaggcagcg
cggaccgccaagatcaaggaaggtgagctgcagcggctgcaggccacgctgaatgtgctg
cgcgatggcgccgcagacaaagtcaagactgcattgctggccgacgcgcgcgaggaggcg
cgcaggacctttgatggcgagcgccagcggctgcagcaggagatcctggagctgaaggct
gcgcgcaaacaggcggaagaggcactcagtaactgcatgcaggcagacaaggccaaagcc
gccgacctgcgcgctgcgtaccaggcgcaccaggatgaggtgcaccgcatcaagcgggag
tgcgaacgtgacatccgcagactgatggacgagatcaaagggaaggagcgggtgatcctg
gccctggagaaggagcttggtgtgcaaaccgggcagacccagcggctgctgttacagaag
gaggctctggatgagcagctggtccaggtcaaggaggcagaacgccaccacagcagccca
aagagggagcttcctcctggcattggtgacatggcggagcttatgggtggccaggatcaa
catatggatgagcgagatgtgaggcgatttcaactgaaaattgctgaactgaattcagtg
attcggaagctagaggacaggaacaccctgctggctgacgagaggaacgaactgctgaag
cgctctcgggagacggaggtgcagctgaagccgctggtggagaagaacaaacgcatgaac
aaaaagaacgaggagctgctgcacagcatccagaggatggaggagaagctcaagagcctc
acgagggagaacgtggagatgaaagaaaagctgtctgctcaggcctcgctaaagcgacac
acgtccctgaatgacctcagtctgaccagggacgagcaggagatagagttcctgaggctg
caggtgctggaacagcagcatgtcatcgatgacctctctctggagagagaacgcctgctg
cgctccaagaggcatcgagggaagagcctgaagccccccaagaagcatgttgtggagaca
ttttttggatttgatgaggagtccgtggactctgaaacattgtccgagacgtcctacaac
acggacaggacagaccggaccccagccacgccggaagaggacttagatgagaccacaacc
agagaagaggctgacctgaggttctgccagctgaccagggagtaccaggctctgcagagg
gcttatgccctgcttcaggagcaggttggggggacactggatgctgaaagggaggcccgg
actcgggagcagcttcaggccgacctgctgaggtgccaggccaaaatcgaggacttagag
aagctgctggttgagaagggacaggacgctgcgtgggtagaggagaagcaggtactcatg
aggacaaaccaggacctgctggagaagatttacagactggagatggaggagaaccagcta
aagagcgaaatgcaagacgccaaggaccagaacgagctgttagaattcagagtgctagaa
ctcgaagtaagagactctatctgttgtaagctctcaaacggagcagacattctctttgag
cccaaactgaaattcatgtaa

DBGET integrated database retrieval system