KEGG   Mus musculus (mouse): 76080
Entry
76080             CDS       T01002                                 

Gene name
Ttpal, 3110080A02Rik, 5830472M02Rik
Definition
(RefSeq) tocopherol (alpha) transfer protein-like
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: CRAL_TRIO CRAL_TRIO_N CRAL_TRIO_2
Other DBs
NCBI-GeneID: 76080
NCBI-ProteinID: NP_083788
MGI: 1923330
Ensembl: ENSMUSG00000017679
Vega: OTTMUSG00000001068
UniProt: Q9D3D0
Position
2; 2 H3
AA seq 343 aa
MSEESDSLRTSPSVASLSENELPLPPPDPPGYVCSLTEDLVTKAREELQEKPEWRLRDVQ
ALRDMVRKEYPYLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHGCRRSWPEVFSNLRPS
ALKDVLNSGFLTVLPHTDPRGCHVLCIRPDRWIPSNYPITENIRAVYLTLEKLIQSEETQ
VNGIVILADYKGVSLSKASHFGPFIAKKVIGILQDGFPIRIKAVHIVNEPRIFKGIFAII
KPFLKEKIANRFFLHGSDLNSLHTNLPRNILPKEYGGTAGELDTASWNAVLLASEEDFVK
EFCQPMPACDNLLGQPLLPEGLISDAQCDDSMRAMKSQLYSCY
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgtcagaagaaagtgactctctgagaaccagcccctctgtggcctcactctccgaaaat
gagctgccactgcctccaccggaccctcccggctacgtgtgctccctgacagaagacttg
gtcaccaaagccagggaagagctgcaggagaagcccgagtggaggctgcgggatgtgcag
gccctccgagacatggtgcggaaggagtacccatacctgagcacgtcgctggacgatgcc
ttcctgttgcgctttctgagggcccgaaagtttgattatgaccgggccctgcagctgctg
gtcaactaccacggctgcaggcggagctggccagaggtcttcagcaacctgaggccgtca
gccctgaaagacgttctcaactctggattccttacagtgctgccccacacggaccccagg
ggctgccatgtcctctgcatccgaccagacagatggataccaagcaactacccaattacc
gagaacatccgagccgtatacttgacattagaaaaactcattcagtccgaggagacccag
gtgaacgggattgttatccttgccgactacaagggagtgagcttatcaaaagcatctcat
tttgggccttttatagccaaaaaggtgattggcatccttcaggatggcttccccattcgg
ataaaagcagttcacatagtgaacgaacctcggatatttaagggcattttcgccatcata
aaaccatttctgaaggagaaaattgctaacaggttcttcctccatgggtctgacctgaac
tctctccacacaaacctgccaaggaatatcctccccaaggagtatgggggcacagctggg
gagctggacactgcctcctggaacgccgtgctgctggcctcagaggaggattttgtgaaa
gagttctgccagcccatgcctgcctgcgacaacctcctgggccagcccctgctacctgag
gggctgatctcagatgcgcagtgtgatgactccatgcgagccatgaagtcccagctctac
tcctgctattag

DBGET integrated database retrieval system