KEGG   Mus musculus (mouse): 76123Help
Entry
76123             CDS       T01002                                 

Gene name
Gpsm2, 6230410J09Rik, LGN, Pins
Definition
(RefSeq) G-protein signalling modulator 2 (AGS3-like, C. elegans)
  KO
K15837  G-protein signaling modulator 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    76123 (Gpsm2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    76123 (Gpsm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_12 GoLoco TPR_1 TPR_7 TPR_2 TPR_8 TPR_10 TPR_4 TPR_16 TPR_MalT TPR_11
Motif
Other DBs
NCBI-GeneID: 76123
NCBI-ProteinID: NP_083798
MGI: 1923373
Ensembl: ENSMUSG00000027883
Vega: OTTMUSG00000007258
UniProt: Q8VDU0 Q3UPG3
Structure
PDB: 

Position
3; 3 F3
AA seq 679 aa AA seqDB search
MEGNLISMREDHSFHVRYRMEASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDLKT
LSAIYSQLGNAYFYLHDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDE
AIVCCQRHLDISRELNDKVGEARALYNLGNVYHAKGKSFGCPGPQDTGEFPEDVRNALQA
AVDLYEENLSLVTALGDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKEFGDKAA
ERRAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEK
AIDYHLKHLAIAQELKDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREVGDKSG
ELTARLNLSDLQMVLGLSYSTNNSMMSENIEIDGSLHGAGAKLGRRHSMENLELMKLTPE
KVPNWNSEILAKQKPLIAKPSAKLLFVNRLKGKKYKSGSACTKVLQDASNSVDHRAPRSQ
KKISSDTIGDEGFFDLLRRFQSNRMDDQRCHLQGNCRTTSTAAASATPKLMKAPSVSVVS
PNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTKGNSPSVLERLMTNDKKEPDEDFFDI
LVKCQGSRLDDQRCAPPSAATKGPTVPDEDFFSLILRSQAKRMDEQRVLLQRDPNRDSEF
GLKELLQNNALLEFKHSGK
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggagggaaatttgataagcatgagggaagaccattcctttcatgtccgctacagaatg
gaagcttcttgccttgagctggccttggaaggagaacgtctatgtaaatcaggggactgc
cgcgctggcgtgtcattttttgaagccgcagttcaagttggaactgaagacctcaaaaca
ctcagtgctatttacagccaactgggcaatgcttacttctacttgcatgactacgccaaa
gcgttagaataccaccaccatgacttaactcttgcacggactattggagaccaacttggg
gaagctaaagccagcggcaatctcggaaacaccttaaaggtgcttgggaattttgatgaa
gcgatagtgtgttgccagcgacacctggatatctccagagagcttaatgacaaggtggga
gaagcaagagcgctctacaatcttggaaatgtctatcacgccaaagggaaaagctttggt
tgcccgggtccgcaggatacaggagagtttccagaagacgtgagaaatgccctacaggca
gctgtggatctctatgaggaaaacctgtccttagtaactgctctaggtgaccgagcagca
caggggcgagcctttgggaaccttggcaacacacactacctcctcggcaacttcagggat
gcagttatagctcacgagcagcgtctcctaattgcaaaggagttcggagataaggcggct
gagagaagagcgtacagcaacctaggaaatgcatacatattcctgggtgaattcgaaact
gcttccgaatactacaagaagacactgctgctggctcggcagcttaaagacagagccgtg
gaagctcagtcttgctacagtcttgggaatacatacactttgcttcaggactacgagaag
gccatcgattaccacctaaagcacttagcaatcgcccaagagctcaaggatcggattggt
gaaggaagagcgtgttggagcttaggaaacgcatacacagctctgggaaatcatgaccaa
gcaatgcattttgctgaaaagcacttggaaatttcaagagaggttggggacaaaagtggt
gaactgactgcgcggctgaacctctcagacctgcagatggttcttggtctgagctacagc
acaaataattccatgatgtctgagaacattgaaattgatggcagcttacatggtgcaggc
gccaagctgggacggagacacagtatggagaacttggaacttatgaagttaacaccagaa
aaggtgccgaattggaacagtgaaattctcgctaaacagaaacctctcattgccaaacca
tctgcaaagctcctgtttgtcaacagactgaagggcaaaaagtacaaaagcggcagcgcc
tgcactaaggttctccaagacgccagcaactccgtggaccaccgcgcgccacgctcccag
aagaaaatcagttcagacacgattggagatgaaggattctttgacttgctaaggcgattt
cagagcaacaggatggatgaccagaggtgccacttacaaggaaactgtcgcacaacatcc
acagcagctgcttctgctacccccaagttgatgaaagcaccgtctgtctctgtggtgtcc
cccaacacagatgagttcttagatcttcttgctagctcacagagccgccgtctggatgac
cagagggccagtttcagtaatttgccagggctccgcctgacaaaaggcaacagtccatct
gtacttgagcgcctgatgacaaatgacaagaaagagcctgatgaagacttcttcgacatc
cttgtaaagtgccaggggtcaagattagatgatcaaagatgtgctcctccatctgctgcc
actaaggggccgactgtcccggatgaggacttctttagcctcatcttacgctctcaagct
aaaagaatggatgagcagagagttctgctgcaaagagatccaaacagagacagtgagttt
ggactaaaggaacttttgcaaaataacgctttgttggaatttaagcattcgggaaaataa

DBGET integrated database retrieval system