KEGG   Mus musculus (mouse): 76132
Entry
76132             CDS       T01002                                 

Symbol
Faxc, 6230409E13Rik, AW742931
Name
(RefSeq) failed axon connections homolog
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: GST_N_4 GST_C_6 Tom37 GST_C_2 GST_N_3
Other DBs
NCBI-GeneID: 76132
NCBI-ProteinID: NP_780443
MGI: 1923382
Ensembl: ENSMUSG00000028246
Vega: OTTMUSG00000004776
UniProt: Q3UMF9
Position
4; 4 A3
AA seq 409 aa
MHWGVGFASSRPCVVDLSWNQSISFFGWWAGSEEPFSFYGDIIAFPLQDYGGIMAGLGSD
PWWKKTLYLTGGALLAAAAYLLHELLVIRKQQELDSKDAIILHQFARPNNGVPSLSPFCL
KMETYLRMADLPYQNYFGGKLSAQGKMPWIEYNNEKVSGTEFIIDFLEEKLGVNLNKSLG
PHERAVSRAVTKMVEEHFYWTLAYCQWVDNLNETRKMLSLSGGGPFSNLLRWVVCHITKG
IVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLGDKKYIMGPKLSTLDATVFGHLAQAM
WTLPGTRPERLIKGELINLAMYCERIRRKFWPEWHHDDDNTIYESEESSEGSKTHTPMLD
FSFYSRTETFEDEGAENSFSRTPDTDFTGHSLFDSDVEMDDYTDHEQCK
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgcactggggggttggctttgcctcgtccaggccgtgcgtggtggacctgagctggaac
cagagcatctccttcttcggctggtgggccgggtccgaggagcccttctccttttatggg
gacatcatcgctttccctttgcaggattacggtgggatcatggcagggctgggctcggat
ccctggtggaagaaaaccctttatttgaccgggggagctttgctggccgcggctgcgtat
ctgctccacgaactcctggtcattaggaaacagcaagagctcgactccaaagatgctatt
attttgcatcagtttgcaagacctaacaatggtgtccccagcttgtctcctttctgtttg
aaaatggaaacttacttaagaatggctgacctaccctatcagaactattttggtggaaaa
ctctctgctcaagggaagatgccttggattgaatataataatgaaaaagtgtctggcaca
gaattcataatcgactttctggaagagaaacttggagtgaacttaaataaaagcctcggc
ccccatgaaagagccgtctcaagagccgtgaccaagatggtggaagagcacttctactgg
acgttagcttattgccagtgggtggacaatctcaatgagacccggaagatgctgtcactt
agtggcggcggtcccttcagtaacctgctcaggtgggtcgtgtgccacataacaaaagga
attgtgaagcgggagatgcacggccacggcattggccgcttctcggaggaagagatttac
atgctgatggagaaggacatgcggtctttagcagggcttttgggtgacaagaagtacatc
atgggacccaagctttccactcttgatgccactgtctttggacacttggcacaggcgatg
tggaccttaccagggacaagaccggagcggctaatcaaaggcgagctgatcaacctggcc
atgtactgcgagaggatcaggaggaaattctggcccgagtggcaccacgatgatgacaac
accatttatgagtctgaggagagcagcgagggcagcaagactcacacacccatgctggat
tttagcttttactccaggacagagacctttgaggacgagggggctgagaacagtttctcc
aggaccccagacacggatttcaccggacactctctctttgactccgatgtggagatggat
gactacacagaccacgaacagtgcaagtga

DBGET integrated database retrieval system