KEGG   Mus musculus (mouse): 76137
Entry
76137             CDS       T01002                                 

Gene name
Mcur1, 6230416A05Rik, AU015498, AV136929, AW554392, C88263, Ccdc90, Ccdc90a
Definition
(RefSeq) mitochondrial calcium uniporter regulator 1
  KO
K22137  mitochondrial calcium uniporter regulator 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    76137 (Mcur1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Mitochondrial calcium uniporter complex
    76137 (Mcur1)
Motif
Pfam: DUF1640 DUF724
Other DBs
NCBI-GeneID: 76137
NCBI-ProteinID: NP_001074528
MGI: 1923387
Ensembl: ENSMUSG00000021371
UniProt: Q9CXD6
Position
13; 13 A4
AA seq 340 aa
MDSGSVAAERPRRTPSRQRLPSSGCGVPARPGVSTLPGGRSWLRPRGRAARASPLLFLLL
VPSPRLAATATATAPRRTLAERSRPGLVLPAAALGAGRNALGRLRLGARRVAALASSRRE
LSLSAKCHQLEHRKENLPLSVSRQLYFDTHALVCLLEANGFTIQQAEIIVSALVKITETN
MNIIYKDMVSKMQQEIALQQVLSKIANVKKDMVILEKSEFSALRAENEKIKLELHQLKQQ
VMDEVTKVRTDTKLNFNLEKSRVKELYSLNEKKMLELRTEIVSLHAQQDRALTQTDRKIE
TEVAGLKTMLEAHKLDTIKYLAGSVFTCLTVALGFYRLWI
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggacagcggctccgtggcggccgagcggccgaggcgcacaccgagtcgccagcggctc
ccgtcctccggctgcggagttccggcgcgcccgggcgtctccacgctgcccggtggacga
agctggctgaggcctcgcggacgggcggcccgcgcgtctccgctgttgttcctcctgctc
gtgccctccccgcgcctggccgccaccgccactgccaccgccccgcgtaggacgctggct
gagcgctcgcgcccggggctcgttctccccgcggccgcgctcggcgccggcaggaacgcg
ctgggccgtctgcggctgggcgcccggcgtgtggccgcgcttgcgagcagccggagagag
ctcagcctgtctgctaagtgccatcagctggagcacagaaaagagaacttgcccctctct
gtgagccggcagctctactttgacacccacgctctggtgtgcttacttgaagcaaatggg
tttaccattcaacaagcagaaatcattgtgtctgcactggtcaagatcacagagaccaac
atgaacatcatctacaaagacatggtcagcaagatgcagcaggaaatcgctctccagcag
gtattatctaagattgctaacgtgaaaaaagatatggtcatcttggagaagagtgagttt
tcagccctcagagcagaaaatgagaaaataaaacttgaactgcaccagttaaagcaacaa
gtgatggatgaagtgaccaaagtccggacagataccaaattaaacttcaatctagaaaaa
agcagagtaaaagaactgtactcgctgaacgagaagaagatgctggaactgaggactgaa
atagtgtcgctgcatgcccagcaagacagagccctgactcagacagaccggaagatagag
acggaggtggctggcctcaagacgatgctggaggcgcacaagcttgatacaatcaaatac
ttagcggggtctgtgtttacgtgcctaacagtggctctgggattttatcgcctgtggata
taa

DBGET integrated database retrieval system