KEGG   Mus musculus (house mouse): 76183
Entry
76183             CDS       T01002                                 
Symbol
Celf6, 6330569O16Rik, Brunol6
Name
(RefSeq) CUGBP, Elav-like family member 6
  KO
K13207  CUG-BP- and ETR3-like factor
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    76183 (Celf6)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    76183 (Celf6)
SSDB
Motif
Pfam: RRM_1 RRM_7
Other DBs
NCBI-GeneID: 76183
NCBI-ProteinID: NP_001298021
MGI: 1923433
Ensembl: ENSMUSG00000032297
UniProt: Q7TN33 D3YX51
Position
9:59485587..59516316
AA seq 344 aa
MNRPIQVKPAASEGRGEDRKLFVGMLGKQQGEEDVRRLFQPFGHIEECTVLRSPDGTSKG
CAFVKFGSQGEAQAAIQGLHGSRTMTGASSSLVVKLADTDRERALRRMQQMAGQLGAFHP
APLPLGACGAYTTAILQHQAALLAAAQGPGLGQVAAVAAQMQHVAAFSLVAAPLLPAAAN
TSPGGNGPGALPGLPAPMGVNGFGSLTPQSNGQPGSDTLYNNGVSPYPAYPSAYAPASTA
FSQQPSALPQQQREGPEGCNLFIYHLPQEFGDAELIQTFLPFGAVVSAKVFVDRATNQSK
CFGFVSFDNPTSAQTAIQAMNGFQIGMKRLKVQLKRPKDANRPY
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgaatcgtccgatccaagtgaagccggctgccagtgagggccgaggagaggaccggaag
ctgtttgtggggatgttgggcaagcagcagggtgaggaggatgtcagacgtctgttccag
cccttcggccatatcgaggagtgcactgtcctgcggagtccggacggtaccagtaaaggc
tgtgcctttgtgaaattcggaagtcaaggggaagcccaagctgccatccagggactacac
ggtagccggacaatgacgggtgcctcctccagcctggtggttaagctggcagacaccgac
cgggagcgcgcgctgcgaaggatgcagcaaatggctggccagctgggtgccttccacccg
gcaccgctgcccctcggggcctgtggcgcctataccactgcgatcctacagcaccaggca
gcgttgctggccgcagcgcagggtccggggttaggccaggtggccgcggtggccgcccag
atgcagcacgtggcggccttcagcttggtggctgcaccgctgttgcccgcggcagccaat
acatcccctggtggcaatggccctggtgcactccctggccttccagcgcccatgggagtc
aatggattcggctccttgaccccccagagcaacggacagccaggctccgacacgctctat
aacaacggggtttccccttacccagcctatccctcggcctatgccccagcgagcacagct
ttttcccaacagccttcagctctgcctcaacaacaaagagaaggccccgaaggctgtaac
ctcttcatctatcacctgcctcaggagtttggggatgcagaactcatacagacattcctg
cccttcggagctgttgtctctgccaaagtttttgtggaccgtgccaccaatcagagcaag
tgttttgggtttgttagttttgacaatccaaccagtgcccagaccgccatccaggccatg
aatggctttcaaatcggcatgaagaggctcaaggtccagctaaagagacctaaggatgcc
aacaggccttactga

DBGET integrated database retrieval system