KEGG   Mus musculus (mouse): 76238Help
Entry
76238             CDS       T01002                                 

Gene name
Grhpr, 1110059D05Rik, 6430629L09Rik, Glxr
Definition
(RefSeq) glyoxylate reductase/hydroxypyruvate reductase
  KO
K00049  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00260  Glycine, serine and threonine metabolism
mmu00620  Pyruvate metabolism
mmu00630  Glyoxylate and dicarboxylate metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    76238 (Grhpr)
   00630 Glyoxylate and dicarboxylate metabolism
    76238 (Grhpr)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    76238 (Grhpr)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     76238 (Grhpr)
    1.1.1.81  hydroxypyruvate reductase
     76238 (Grhpr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored KR IlvN Shikimate_DH TrkA_N ThiF
Motif
Other DBs
NCBI-GeneID: 76238
NCBI-ProteinID: NP_525028
MGI: 1923488
Ensembl: ENSMUSG00000035637
Vega: OTTMUSG00000007141
UniProt: Q91Z53 Q3T9Z2
Position
4; 4 B1
AA seq 328 aa AA seqDB search
MKPARLMKVFVTGPLPAEGRAALAQAADCEVEQWNSDDPIPRKDLEQGVVGAHGLLCRLS
DRVDKKLLDAAGANLRVISTLSVGVDHLALDEIKKRGIRVGYTPGVLTDATAELAVSLLL
TTCRRLPEAIEEVKNGGWSSWSPLWMCGYGLSQSTVGIVGLGRIGQAIARRLKPFGVQRF
LYTGRQPRPQEAAEFQAEFVPIAQLAAESDFIVVSCSLTPDTMGLCSKDFFQKMKNTAIF
INISRGDVVNQEDLYQALASGQIAAAGLDVTTPEPLPPSHPLLTLKNCVILPHIGSATYK
TRNTMSLLAANNLLAGLRGEAMPSELKL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccggcgcgactcatgaaggtgttcgtcactggcccgttgcctgccgagggcagg
gctgcgctcgcccaggccgcagactgtgaggtggaacagtggaattcggatgaccccatc
cccagaaaggatctggagcaaggtgtggtgggggcccatggcttgctctgccgcctctct
gaccgtgtggacaagaaacttctggatgccgcaggagccaacctcagagtcatcagcacc
ttgtctgtgggggtcgaccacttggctttggatgaaatcaagaagcgcgggatccgggtg
ggctacacgccaggtgtcctgacagatgccactgcagaactcgccgtctccctcctcctc
accacctgccgccggttgccggaggccatagaggaagtgaagaacggcggctggagctcc
tggagcccattatggatgtgcggctacggactctcgcagagcactgttggcattgtgggg
ctggggcgcataggtcaggccatcgctcgacgactgaaaccattcggtgtccagagattt
ctttacacggggcgccagcccaggcctcaggaagcagccgagtttcaggcagagtttgtg
cctattgctcagctggccgcagagtcagacttcattgtcgtgtcctgctccttaacaccc
gataccatggggctctgcagcaaggatttcttccagaagatgaagaacacagctatcttc
atcaacatcagcagaggagatgtggtaaaccaggaagacctgtaccaggcactagccagt
ggtcagattgcagcagcgggactggatgtgaccacccctgaaccactgcctccgagccac
cccctgctgaccctcaagaactgcgtgatcctgccccacattggcagtgccacctacaaa
actcgcaacaccatgtccttgctggcggctaacaacttgctggctggcctaagaggggag
gccatgcccagcgaactcaagctgtaa

DBGET integrated database retrieval system