KEGG   Mus musculus (mouse): 76260
Entry
76260             CDS       T01002                                 

Symbol
Ttc8, 0610012F22Rik, AV001447, BBS8
Name
(RefSeq) tetratricopeptide repeat domain 8
  KO
K16781  tetratricopeptide repeat protein 8
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    76260 (Ttc8)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   BBSome complex
    76260 (Ttc8)
SSDB
Motif
Pfam: TPR_2 TPR_1 TPR_12 TPR_8 TPR_14 TPR_7 TPR_19 TPR_17 TPR_16 TPR_9 TPR_15 TPR_MalT PknG_TPR Coatomer_E TPR_10 DUF5112 ChAPs
Other DBs
NCBI-GeneID: 76260
NCBI-ProteinID: NP_938053
MGI: 1923510
Ensembl: ENSMUSG00000021013
Vega: OTTMUSG00000023820
UniProt: Q8VD72
Position
12; 12 E
AA seq 515 aa
MGSEMEPLLRAWSYFRRRKFQLCADLCTQMLEKSPYDQEPAPDLPVSQAAWILKARALTE
MVYIDEIDVDQEGIAEMILDENAIAQVPRPGTSLKLPGTNQTGGPTQAVRPITQAGRPIT
GFLRPSTQSGRPGTMEQAIRTPRTAYTARPITSSSGRFVRLGTASMLTSPDGPFINLSRL
NLTKYSQKPKLAKALFEYILHHENDVKMALDLASLSTEYSQYKDWWWKVQIGKCYYRLGM
YREAEKQFKSALKQQEMVDTFLYLAKVYIILDQPVTALNLFKQGLDKFPGEVTLLCGIAR
IYEEMNNSSSAAEYYKEVLKQDNTHVEAIACIGSNHFYSDQPEVALRFYRRLLQMGVYNC
QLFNNLGLCCFYAQQYDMTLTSFERALSLAENEEEAADVWYNLGHIAVGIGDTNLAHQCF
RLALVHNNHHAEAYNNLAVLEMRKGHVEQARALLQTASSLAPHMYEPHFNFATVSDKIGD
LQRSYVAAQKSEVAFPEHVDTQHLIKQLKQHFAML
NT seq 1548 nt   +upstreamnt  +downstreamnt
atgggctcagagatggagccactgctccgggcctggagctattttagacgcaggaagttc
cagctctgcgccgatctatgcacgcagatgctggagaaatccccttatgatcaggaacca
gctcctgatttgccagtgtctcaggcggcttggattttgaaagcacgggcgctgacagag
atggtgtacatagatgaaattgatgtggaccaggaaggaattgctgaaatgatcctggat
gaaaatgctattgctcaggtcccacgccctggcacatctttgaagctccctggcactaac
caaacaggaggaccgactcaagctgtcaggccaatcactcaagctggaagacccataaca
ggtttccttaggcccagcacacagagtggaagaccaggtacaatggaacaggccatcaga
acacccagaactgcctacacagcacgacctatcactagctcatctggaagattcgtcaga
ctggggactgcttccatgcttacaagtcccgatggaccatttataaatttatctagactg
aatttaacaaaatattcccagaagcctaagttggcaaaggctctatttgaatatattctc
caccatgaaaacgatgttaagatggctttggatttggcgtccctttccacggagtattct
cagtacaaggactggtggtggaaggtacagattggaaaatgttactacaggttaggaatg
taccgtgaagcagagaaacagtttaaatcagccttgaagcagcaggaaatggtagacaca
tttctctatctggcaaaagtttatatcatattggatcaacctgtgactgctttaaatcta
tttaaacaaggcttagataagtttccaggagaggtgaccctgctttgtggaattgccagg
atctatgaggaaatgaataacagttcatctgcagcagagtactacaaagaagttctaaaa
caagacaatactcacgtggaagccatcgcctgcattggaagcaaccacttttattctgac
cagccagaggttgcccttcggttttacaggcgcctcttgcagatgggagtttataactgc
cagcttttcaacaacctgggcctgtgctgcttctatgcccagcagtacgatatgaccctg
acctcgtttgaacgtgccctttccctggctgaaaatgaagaagaggcagctgatgtctgg
tacaacctggggcacatagctgtgggaatcggagatacaaacttggcccaccaatgcttc
aggctggccctggtccacaacaaccaccatgctgaagcctacaacaacctggcagtgctg
gagatgcggaagggtcacgttgaacaggcacgcgcgctcttacaaaccgcatcgtctttg
gcaccccacatgtatgagccacactttaatttcgcaacagtctctgataagattggagat
cttcagagaagctacgttgctgctcagaagtctgaagtggcgtttcctgaacacgtggac
acacagcacttaattaagcagctgaagcagcactttgctatgctctga

DBGET integrated database retrieval system