KEGG   Mus musculus (mouse): 76261
Entry
76261             CDS       T01002                                 

Symbol
0610040J01Rik, AI662686
Name
(RefSeq) RIKEN cDNA 0610040J01 gene
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF4699
Other DBs
NCBI-GeneID: 76261
NCBI-ProteinID: NP_083830
MGI: 1923511
Ensembl: ENSMUSG00000060512
Vega: OTTMUSG00000055109
UniProt: Q99K99
Position
5:63969834..64056968
AA seq 313 aa
MGCRCCKMIQSYLFDPVQVPSPGFVNEVNNCKLEEDDTVRLKGTQNSEVEVPRNALHDGS
LSNSESRGSTTGLPHQGPLPQEDSEERPCVEKQGIVNGISPTATLQSVRSSRLHQVDNSS
WASSPWVATIDSAHLAQPFLEGEDYRKQSCLLPTLEGTQMVGHGDCRAPAEALAVADHIP
YIPAPDYPQLWSPTVDNADPEEKDCLFENHSEVEPLPGIQPRVSQLGLNVPFSLQRSWDS
LNEAGTTEVLSDYFKEEGPTHPTPAADSGSEREDPHTYNGDREGVVVDEDAEVAEALAAL
EAATAGEDADDAD
NT seq 942 nt   +upstreamnt  +downstreamnt
atggggtgcaggtgttgtaagatgatacaaagctatctctttgatccagttcaagtgccc
tcgcctggttttgtcaatgaagtaaacaactgcaagttggaggaagatgacactgtcaga
ctaaaaggcacccagaacagtgaggttgaggtgcccaggaatgccctgcacgatgggagc
ctgagcaattcagagagcagaggcagtacaactggtctacctcaccaaggaccgctcccc
caggaggactcagaagagagaccctgtgtggagaagcagggtattgtcaatggcatcagc
cccactgctactctgcagtcggtcaggagttccaggctccaccaggttgacaatagctcc
tgggccagcagcccctgggtagccaccatagacagtgctcacctggctcaacccttcctt
gaaggagaagactacaggaagcaaagctgcctgctgcccaccttggaagggacccagatg
gtgggacatggagactgcagagcccctgcggaggccttggcagtggcagatcacatccca
tacataccagccccagattatccccagctctggagccccacagtagacaacgcagaccct
gaagaaaaggattgtctttttgaaaaccactctgaggtggagccccttccgggaattcag
cccagggtgagccagctgggtttgaacgtgcccttctccctgcagagaagctgggactca
ctgaatgaggcagggaccacagaagttctgagtgactacttcaaagaggagggtcccact
caccctacgccagcggctgattctggaagtgagcgggaagacccccacacctacaacggg
gacagggagggtgttgtggtagatgaggatgctgaggtggcagaagccctcgcagcatta
gaagctgctaccgcaggagaagatgcagatgatgccgattag

DBGET integrated database retrieval system