KEGG   Mus musculus (mouse): 76263
Entry
76263             CDS       T01002                                 

Gene name
Gstk1, 0610025I19Rik, AW260476, Dsb, DsbA-L
Definition
(RefSeq) glutathione S-transferase kappa 1
  KO
K13299  glutathione S-transferase kappa 1 [EC:2.5.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00480  Glutathione metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu01100  Metabolic pathways
mmu04146  Peroxisome
mmu05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    76263 (Gstk1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    76263 (Gstk1)
   00982 Drug metabolism - cytochrome P450
    76263 (Gstk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    76263 (Gstk1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    76263 (Gstk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     76263 (Gstk1)
SSDB
Motif
Pfam: DSBA Helicase_C_3 DUF4964
Other DBs
NCBI-GeneID: 76263
NCBI-ProteinID: NP_083831
MGI: 1923513
Ensembl: ENSMUSG00000029864
Vega: OTTMUSG00000057543
UniProt: Q9DCM2
Position
6; 6 B2.1
AA seq 226 aa
MGPAPRILELFYDVLSPYSWLGFEVLCRYQHLWNIKLQLRPTLIAGIMKDSGNQPPAMVP
RKGQYIFKEIPLLKQFFQVPLNIPKDFFGETVKKGSINAMRFLTTVSMEQPEMLEKVSRE
IWMRVWSRDEDITEYQSILAAAVKAGMSTAQAQHFLEKISTQQVKNKLIENTDAACKYGA
FGLPTTVAHVDGKTYMLFGSDRLELLAYLLGEKWMGPVPPTANARL
NT seq 681 nt   +upstreamnt  +downstreamnt
atggggccggcgccgcgcatcctggaactcttctacgacgtgctgtccccgtactcctgg
ctgggctttgaggtcctatgcagataccaacacctctggaatataaagctgcagttgcgg
cccactttaatcgctgggatcatgaaagacagcggaaaccaaccacctgctatggttccc
cgaaaaggccagtacatcttcaaagagattcctctcctgaagcagttcttccaggttccc
ctcaacatacccaaggatttctttggtgagactgtgaagaaaggaagtataaatgccatg
cgcttcctcaccactgtaagcatggagcaaccagagatgctggagaaggtgtccagagag
atatggatgcgtgtatggtctcgagatgaagatatcacggagtatcagagcattctggct
gcagcagtgaaggctggaatgtccacagcgcaagcccaacactttctggagaagatctcc
acacaacaggtgaagaacaagctcattgagaacacggatgcagcctgcaaatatggggcc
tttgggctacccaccactgttgcccatgtggatggtaaaacctacatgttatttgggtct
gaccgcttggagttgctagcttacctgctaggagagaagtggatgggccctgtaccccca
actgcgaatgccagactttaa

DBGET integrated database retrieval system