KEGG   Mus musculus (mouse): 76282
Entry
76282             CDS       T01002                                 

Gene name
Gpt, 1300007J06Rik, 2310022B03Rik, A, ALT, ALT1, Gpt-, Gpt-1, Gpt1
Definition
(RefSeq) glutamic pyruvic transaminase, soluble
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00220  Arginine biosynthesis
mmu00250  Alanine, aspartate and glutamate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01210  2-Oxocarboxylic acid metabolism
mmu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    76282 (Gpt)
   00220 Arginine biosynthesis
    76282 (Gpt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    76282 (Gpt)
Enzymes [BR:mmu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     76282 (Gpt)
Amino acid related enzymes [BR:mmu01007]
 Aminotransferase (transaminase)
  Class I
   76282 (Gpt)
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 76282
NCBI-ProteinID: NP_877957
MGI: 95802
Ensembl: ENSMUSG00000022546
UniProt: Q8QZR5 Q566C3
Position
15 D3; 15 36.28 cM
AA seq 496 aa
MASQRNDRIQASRNGLKGKVLTLDTMNPCVRRVEYAVRGPIVQRALELEQELRQGVKKPF
TEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDAKRRAERILQACGGHSL
GAYSISSGIQPIREDVAQYIERRDGGIPADPNNIFLSTGASDAIVTMLKLLVAGEGRART
GVLIPIPQYPLYSAALAELDAVQVDYYLDEERAWALDIAELRRALCQARDRCCPRVLCVI
NPGNPTGQVQTRECIEAVIRFAFEEGLFLMADEVYQDNVYAEGSQFHSFKKVLTEMGPPY
ATQQELASFHSVSKGYMGECGFRGGYVEVVNMDAEVQKQMAKLMSVRLCPPVPGQALMGM
VVSPPTPSEPSFKQFQAERQEVLAELAAKAKLTEQVFNEAPGIRCNPVQGAMYSFPQIQL
PLKAVQRAQDLGLAPDMFFCLCLLEETGICVVPGSGFGQQEGTYHFRMTILPPMEKLRVL
LEKLRHFHAKFTHEYS
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggcctcacaaaggaatgaccggatccaggcttcaaggaatggactgaaggggaaggtg
ctaactctggataccatgaacccatgtgtgcggagggtggagtatgcagtccgaggcccc
atcgtgcaacgtgccttggagctggagcaggagctgcgccagggtgtgaagaagcctttt
actgaggttatccgtgccaatattggggatgcacaagccatggggcagagacccatcacc
ttcttccgccaggtcctggccctctgtgtctaccccaatcttctgagcagtccggacttc
ccagaggatgccaagagaagggcagaacgcatcttgcaggcatgcgggggccacagcctg
ggtgcctatagcattagctctggaatccagccgattcgggaggatgtggcgcaatatatt
gagaggagagacggaggcatccctgcagacccgaacaacatatttctgtccacaggggcc
agcgatgccatcgtgaccatgctcaagctgctggtagccggcgagggccgtgcgcgaacc
ggtgtactcattcccattcctcagtacccactgtactcagctgcgctggctgagctggac
gccgtgcaagtggactactacctggacgaagagcgcgcctgggctcttgacatcgctgag
ctgcggcgcgctctgtgccaggcacgtgaccgctgctgccctcgagtactatgcgtcatc
aaccccggcaaccccacggggcaggtgcagacccgtgaatgcatcgaggccgtaatccgc
tttgctttcgaagagggactcttcctgatggctgatgaggtataccaagacaatgtatat
gctgagggctctcagttccattcattcaagaaggtgctcacggagatggggccaccatat
gccacgcagcaggagctcgcgtctttccactcagtctctaagggctacatgggcgagtgc
gggtttcgtggtggctatgtggaagtggtaaacatggatgccgaggtgcagaaacagatg
gcgaaactgatgagcgtgcggttgtgtccaccagtgccgggccaggctttgatgggcatg
gtggtcagtccgccaaccccctcggagccgtccttcaagcagtttcaagcagagaggcag
gaggtgctggctgaactggcagccaaggctaaactcacggagcaggtcttcaacgaggcc
cccgggatccgctgcaacccggtgcagggcgctatgtattccttccctcaaattcagctg
cctttgaaagcagtgcagcgtgcgcaggacctgggcctggcccctgacatgttcttctgt
ctgtgcctcctggaagagactggcatctgcgttgtgcctgggagtggctttgggcagcag
gagggcacctatcatttccggatgaccattctgccccccatggagaaactgcgggtgctg
ctggagaaactgaggcacttccatgctaaattcactcatgagtactcctga

DBGET integrated database retrieval system