KEGG   Mus musculus (mouse): 76293Help
Entry
76293             CDS       T01002                                 

Gene name
Mfap4, 1110007F23Rik
Definition
(RefSeq) microfibrillar-associated protein 4
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C
Motif
Other DBs
NCBI-GeneID: 76293
NCBI-ProteinID: NP_083844
MGI: 1342276
Ensembl: ENSMUSG00000042436
Vega: OTTMUSG00000005836
UniProt: Q9D1H9
Position
11 B2; 11 37.96 cM
AA seq 257 aa AA seqDB search
MKALPALPLMLMLLSMPPPCAPQASGIRGDALEKSCLQQPLDCDDIYAQGYQEDGVYLIY
PYGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWSDYKLGFGRADGEYWLGLQNLH
LLTLKQKYELRVDLEDFENNTAYAKYIDFSISPNAISAEEDGYTLYVAGFEDGGAGDSLS
YHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQW
KGFYYSLKRTEMKIRRA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccctcccagccctgccactgatgctgatgctgctctccatgcctcccccctgc
gccccgcaagcctctgggatccggggagatgctctggagaagtcctgtcttcagcaaccc
ctggactgtgatgatatctacgcccagggctatcaggaagacggcgtgtatctcatctac
ccctatggccccagtgtgccggtgcccgtcttctgcgacatgacaactgagggcggcaag
tggacggttttccagaaaagattcaacggctcagtgagtttcttccggggctggagcgac
tacaagctgggctttggccgtgctgacggggagtactggctggggctgcagaacctgcac
ctcctgacactgaagcagaagtatgagctgcgcgtggacttggaagactttgagaacaac
acagcctatgccaagtacattgacttctccatctcccccaacgccatcagtgctgaggag
gatggctataccctctacgtggctggcttcgaggatggcggggcaggtgactcactgtcc
taccacagtggccagaagttctccacctttgatcgggaccaggacctcttcgtgcagaac
tgtgcagccctctcctcaggagccttctggttccgaagctgccatttcgccaatctcaac
ggtttctacctgggtggttcccatctctcctatgccaatggcatcaattgggcccaatgg
aaaggcttctattactccctcaagcgcacggagatgaaaattcgtcgggcctga

DBGET integrated database retrieval system