KEGG   Mus musculus (mouse): 76295Help
Entry
76295             CDS       T01002                                 

Gene name
Atp11b, 1110019I14Rik, ATPIF, ATPIR, mKIAA0956
Definition
(RefSeq) ATPase, class VI, type 11B
  KO
K01530  phospholipid-translocating ATPase [EC:7.6.2.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    76295 (Atp11b)
Enzymes [BR:mmu01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.1  P-type phospholipid transporter
     76295 (Atp11b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PhoLip_ATPase_C PhoLip_ATPase_N Hydrolase Cation_ATPase E1-E2_ATPase Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 76295
NCBI-ProteinID: NP_083846
MGI: 1923545
Ensembl: ENSMUSG00000037400
Vega: OTTMUSG00000022012
UniProt: Q6DFW5
Position
3; 3 B
AA seq 1175 aa AA seqDB search
MWRWVRQQLGFDPPHQSDTRTIYIANRFPQNGLYTPQKFIDNRIISSKYTIWNFVPKNLF
EQFRRVANFYFLIIFLVQLMIDTPTSPITSGLPLFFVITVTAIKQGYEDWLRHNSDNEVN
GAPVYVVRSGGLVKTRSKNIRVGDIVRIAKDEIFPADLVLLSSDRLDGSCHVTTASLDGE
TNLKTHVSVPETAVLQTVANLDSLIAVIECQQPEADLYRFMGRMIITQQMEEIVRPLGPE
SLLLRGARLKNTKEIFGVAVYTGMETKMALNYKSKSQKRSAVEKSMNTFLIIYLIILISE
AIISTILKYTWQAEEKWDEPWYNQKTEHQRNSSKILRFISDFLAFLVLYNFIIPISLYVT
VEMQKFLGSFFIGWDLDLYHEESDQKAQVNTSDLNEELGQVEYVFTDKTGTLTENEMQFR
ECSINGLKYQEINGKLVPEGPSPDSTEGEVPFLGSLSHLSNSAHLTATSLRTSPESETEL
IKEHDLFFKAVSLCHTVQISNVQTDGIGDGPWQPNLAPAQLEYYASSPDEKALVEAAARA
GIIFVGISEETMEVKVLGRLERYKLLHILEFDSDRRRMSVIVQAPSGEKLLFAKGAESSI
LPKCIGGEIAKTRIHVDEFALKGLRTLCIAYRQFTAKEYEDVDRRLFEARTALQHREEKL
ADAFQYIEKDLILLGATAVEDRLQDKVRETIEALRMAGIKVWVLTGDKHETAVSVSLSCG
HFHRTMNILELINQKSDSGCAEQLRQLARRITEDHVIQHGLVVDGTSLSLALREHEKLFM
EVCRNCSAVLCCRMAPLQKAKVIRLIKISPEKPITLAVGDGANDVSMIQEAHVGIGIMGK
EGRQAARNSDYAIARFKFLSKLLFVHGHFYYIRIATLVQYFFYKNVCFITPQFLYQFYCL
FSQQTLYDSVYLTLYNICFTSLPVLIYSLVEQHIDPHVLQSKPTLYRDISKNGLLSIKAF
LYWTVLGFSHAFIFFFGSYFLVGKDTSLLGNGQMFGNWTFGTLVFTVMVITVTVKMALET
HFWTWINHLVTWGSIIFYFIFSLFYGGILWPFLGSQNMYFVFIQLLSSGSAWFAILLMVV
TCLFIDVVKKVFDRQLHPTSTEKAQLAEAHSSVKCLDSVCCFPGETPCASVGRMLERVIG
RCSPNHISRLWNASDPFYTNDRSILTLSPMDSSTC
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgggtccggcagcagctgggttttgacccaccacatcaaagtgacacaaga
actatttacatagccaacaggtttcctcagaatggcctttacacacctcagaaatttata
gataaccggatcatttcatctaagtatactatatggaattttgttccaaaaaatttattt
gaacagttcagaagagtggcaaacttttattttcttattatatttttggttcagcttatg
attgatacacctaccagtccaattaccagtggacttccattattctttgtgataacagta
actgccataaaacagggttatgaagactggttacgccataactcagataatgaagtaaac
ggagctcctgtctatgttgtcagaagtggggggcttgtaaaaactcgatccaaaaacatt
cgggtgggtgatattgttcgtatagccaaagatgaaatttttcctgcagatttggtgctt
ctgtcctcagatcgacttgatggttcatgtcatgtgacaactgctagtttggatggagag
acaaacctaaagacacatgtgtcagttccagaaacagcagtattacaaacagttgccaac
ttggacagtctcatagctgtaatagaatgccaacagccagaagcagatttatacagattt
atgggacgaatgataataactcaacaaatggaagaaattgtaagacctctgggaccagag
agtctcttgcttcgtggagccagattaaaaaatacaaaagaaatttttggtgtggctgta
tacactggaatggaaactaagatggcactaaattacaagagcaagtcacagaaaagatct
gcagtagaaaaatcaatgaacacatttttaataatttacctaataatacttatttctgag
gccatcatcagtacgatcttgaaatatacctggcaagctgaagaaaaatgggatgaacct
tggtataaccaaaaaacagaacatcaaagaaacagtagtaagattctgagatttatttct
gacttccttgcttttttggtactctacaatttcatcattccaatttctctgtatgtgaca
gttgagatgcagaaatttcttggatcattttttattggctgggatcttgatctgtatcac
gaagagtcagatcagaaagctcaagtcaatacttctgatctgaatgaagagcttgggcag
gtggaatatgtatttacagataaaactggaacactgacagaaaatgagatgcagtttcga
gaatgttcaattaatggcctgaaataccaagaaatcaatggtaaacttgtacctgaagga
ccaagcccagactccacagaaggagaagtgcctttccttggtagtttatcccatctcagc
aactcagcccatctcacagccacttctcttagaaccagtcctgaaagtgaaactgagcta
atcaaagaacacgatctgttctttaaagcagtcagtctttgccatactgtacagatcagc
aatgttcaaactgacggcatcggggatggtccctggcagcccaacctggcacctgcacag
ctggagtactatgcatcttcaccagatgaaaaggctctggtggaagctgcggcaagagct
ggtattatatttgtaggcatttctgaagaaactatggaggttaaagtacttgggagattg
gaaaggtacaaattgcttcatattctggaatttgattcagatcgtaggagaatgagtgta
attgttcaggcaccttcaggtgagaagcttttatttgctaaaggagcagaatcttcaatt
ctccctaaatgtataggtggagaaatagcaaaaaccagaattcatgttgatgagtttgct
ttgaaaggactgcggacactgtgtatagcttacagacagtttacagctaaagagtatgaa
gatgtagacaggcgcctgtttgaggccagaactgccttgcagcatcgggaagagaaattg
gctgatgccttccagtacattgagaaagacctgatattgctaggagctacagcagtggaa
gacagactacaagataaagttcgagaaactattgaagcactgagaatggctggtattaaa
gtatgggtacttactggagacaaacatgaaacagctgttagtgtgagtttatcttgtgga
cattttcatagaactatgaatatcctggaacttatcaaccagaagtcagatagtggatgt
gctgaacagttgaggcagcttgccagaagaattacagaggaccatgtgattcagcatggg
ctagtagtagatgggaccagcttatctcttgcactcagggaacatgaaaagctctttatg
gaagtttgcagaaactgttcagctgtattatgttgtcgcatggcacctttacagaaagca
aaagtaataagactgataaaaatctctcctgagaaaccgataacactggctgttggtgat
ggtgctaatgatgtaagcatgatacaagaagcgcatgttggcataggaatcatgggtaaa
gagggaagacaagctgcaagaaacagtgactatgcaatagctagatttaaatttctctcc
aaattactttttgttcacggtcatttttattatattagaatagctacccttgtacagtat
tttttttataagaatgtgtgctttatcacaccccagtttttatatcagttctactgtttg
ttttctcaacaaacactgtatgacagcgtgtacctgactttatacaatatctgttttact
tccctacctgttctcatatatagtcttgtggaacaacatatagacccacacgtattacag
agcaagcctaccctctatcgggacattagtaaaaacggtctcttgagcattaaagcattt
ctttactggaccgtcctgggtttcagccatgccttcattttcttctttggatcctacttt
ctagtggggaaggatacatctttgcttggaaatggtcagatgtttggaaactggacattt
ggtactttggtcttcacagtcatggttattacagtcacagtaaagatggcattggaaact
catttctggacttggatcaaccatcttgttacctggggatctattatattttattttata
ttttctttgttttatggtggaattctctggccatttttgggctcccagaatatgtacttt
gtatttattcagctcctgtcaagtgggtcagcttggtttgccatactcctcatggttgtt
acatgtctattcattgatgttgtgaagaaagtgtttgatcgacagcttcatcctacaagt
acagaaaaggcacagcttgctgaagctcattccagtgtcaagtgcttggactccgtgtgc
tgtttcccaggagagaccccgtgtgcgtctgttggaagaatgctggagcgagtcatagga
cggtgtagtcccaaccatatcagcaggttgtggaatgcatcggatccattctataccaat
gacaggagcatcttgactctctcgccaatggactcatctacttgttaa

DBGET integrated database retrieval system