KEGG   Mus musculus (mouse): 76303Help
Entry
76303             CDS       T01002                                 

Gene name
Osbp, 1110018F06Rik, AW559088, mKIAA4220
Definition
(RefSeq) oxysterol binding protein
  KO
K20456  oxysterol-binding protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    76303 (Osbp)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Oxysterol-binding proteins
    76303 (Osbp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Oxysterol_BP PH PH_8 PH_6 PH_11 Syntaxin-6_N HlyD_D23
Motif
Other DBs
NCBI-GeneID: 76303
NCBI-ProteinID: NP_001028346
MGI: 97447
Ensembl: ENSMUSG00000024687
UniProt: Q3B7Z2
Position
19 A; 19 8.58 cM
AA seq 805 aa AA seqDB search
MAATELRGVVGPGPAAIAAPGGGGAGPPAVGGGGGRGDAGPGPGVAAATAATAGGPGPGA
GGVAAGGPGSAPPAAGSGGSGAGGSGSAREGWLFKWTNYIKGYQRRWFVLSNGLLSYYRS
KAEMRHTCRGTINLATANITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAKAK
AVKMLAESDDSGDEESVSQTDKTELQSTLRTLSSKVEDLSTCNDLIAKHGTALQRSLSEL
ESLKLPAESNEKIKQVNERATLFRITSNAMINACRDFLMLAQTHSKKWQKSLQYERDQRI
RLEETLEQLAKQHNHLERAFRGATVLPANPPGSAGSGKDQCCSGKGDMSDEDDENEFFDA
PEIITMPENLGHKRTGSNISGASSDVSLDEQYKHQLEETKKEKRTRIPYKPNYSLNLWSI
MKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFTVS
SYSTTVFRTSKPFNPLLGETFELDRLEENGYRSICEQVSHHPPAAAHHAESKNGWTLRQE
IKITSKFRGKYLSIMPLGTIHCIFHSTGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVN
HKTGDKCNLKFVPYSYFSRDVARKVTGEVTDPSGKVHFALLGTWDEKMDCFKVQAASGEN
GGDARQRGHEAEDSRVMLWKRNPLPKNAENMYYFSELALTLNAWEGGTAPTDSRLRPDQR
LMENGRWDEANAEKQRLEEKQRLSRKKREAEAAKATEDGTPHDPYKALWFERKKDPVTRE
LTHIYSGEYWECKEKQDWGSCPDIF
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaccgagctgagaggagtggtggggccgggcccggcagccatcgcggctccg
ggcggcggcggcgcgggtccacccgcggtgggaggcggcggcggacgcggggacgcgggg
cccggccccggggtggcggccgcgacggcggcgacggcgggcggcccgggccccggggcc
ggaggagtggcggcaggcggcccgggctctgcaccgccagccgcgggctcgggcggttcg
ggcgccgggggctcgggctcggctagagagggctggctcttcaaatggaccaattacatc
aaaggctaccagcggcgatggttcgtgctgagcaacgggctcctaagctactacaggtcc
aaggcagagatgagacacacctgccgaggtaccatcaacctcgccacagccaacatcact
gtggaggactcttgcaacttcatcatctccaatggcggtgctcagacctaccacttgaag
gccagctccgaagtagagcgtcagcgctgggtgacagccttagaactggccaaggccaag
gctgtgaagatgctggccgaatcagatgactcaggagatgaagagtctgtctcacagact
gacaagaccgagctccagagcaccctgcgaacactctccagcaaagtggaggacctcagc
acgtgcaacgacttgatagctaagcatggcaccgccctgcagcgttccctcagtgagctg
gagtccctgaagctgcctgctgagagcaatgagaaaatcaagcaggtcaatgaacgagcc
acgctttttaggataacatccaatgccatgatcaatgcttgcagagatttcctcatgtta
gcccagacacacagtaagaagtggcagaagtcactacagtatgaaagagaccagcgaatc
cgactggaagaaactcttgagcagctggcaaagcagcacaatcacctggagagagccttc
cggggagccacagtgctgccagcaaaccctccgggcagcgctgggtctggtaaagatcag
tgctgttctggcaaaggggacatgagcgatgaagatgacgagaatgagttttttgatgca
ccagagattatcaccatgcctgaaaatttgggccacaaacgtactggcagcaatatcagt
ggggccagcagtgatgtcagccttgatgaacagtacaagcatcagctggaggagaccaag
aaggaaaagagaaccagaataccatataagccaaactacagcctcaacttgtggagcatc
atgaagaactgcattggaaaggagctctctaagatcccaatgccggtaaactttaatgag
cccttgtccatgcttcagcgccttactgaagatctggagtaccatgagctgttagacaga
gctgcaaagtgtgagaactctctagaacagctctgctatgttgcagccttcactgtttcc
tcctattccactaccgtcttccgaaccagcaagccattcaaccctctccttggggagaca
tttgaactggaccgactggaggagaatgggtatcggtccatctgtgagcaggtgagtcat
catccccctgctgctgcgcaccatgctgaatccaaaaatggctggacattgcgtcaggaa
attaaaatcaccagcaagtttcgaggcaaatacctctccattatgccccttggtactatc
cactgcattttccactcaactgggcaccattacacttggaaaaaagttaccacaacagta
cacaacattattgtgggcaagttgtggatagatcagtctggtgagattgacattgtaaat
cacaagacaggagacaagtgtaatcttaaatttgttccttatagctacttctctcgggat
gtagcaagaaaggtgacaggtgaagtgacagacccatcaggaaaagttcactttgccctc
ctggggacatgggatgagaaaatggattgtttcaaagtacaggcagcctccggggagaat
gggggtgatgctcggcagagaggccatgaagcagaagacagcagggtcatgctgtggaag
aggaacccattaccgaagaatgcagagaacatgtactacttctcagagcttgccctcact
ctcaatgcctgggaaggtggcactgctcccacggacagccggctgcggcccgaccagaga
ctcatggaaaacgggcgttgggatgaagcaaatgctgagaagcagcgcctggaggagaaa
cagcggctttccaggaagaagagagaagcagaagctgcgaaagccacggaagatggcaca
ccacatgacccctataaagcactgtggtttgagcggaagaaggaccctgtcaccagggag
ctaacccatatttatagtggcgagtactgggaatgtaaggaaaagcaggactggggttct
tgcccagatattttctga

DBGET integrated database retrieval system