KEGG   Mus musculus (mouse): 76308
Entry
76308             CDS       T01002                                 

Symbol
Rab1b, 1110011F09Rik
Name
(RefSeq) RAB1B, member RAS oncogene family
  KO
K07875  Ras-related protein Rab-1B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    76308 (Rab1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    76308 (Rab1b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    76308 (Rab1b)
   04031 GTP-binding proteins [BR:mmu04031]
    76308 (Rab1b)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    76308 (Rab1b)
 Autophagy
  Other autophagy associated proteins
    76308 (Rab1b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   76308 (Rab1b)
  Exosomal proteins of other body fluids (saliva and urine)
   76308 (Rab1b)
  Exosomal proteins of colorectal cancer cells
   76308 (Rab1b)
  Exosomal proteins of bladder cancer cells
   76308 (Rab1b)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab1/35 [OT]
    76308 (Rab1b)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase SRPRB MMR_HSR1 GTP_EFTU Gtr1_RagA AAA FeoB_N AAA_7 AAA_16 ABC_tran AAA_22 PduV-EutP AAA_29 Septin AAA_5 TniB
Other DBs
NCBI-GeneID: 76308
NCBI-ProteinID: NP_083852
MGI: 1923558
Ensembl: ENSMUSG00000024870
UniProt: Q9D1G1 Q0PD66
Position
19; 19 A
AA seq 201 aa
MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQ
IWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVG
NKSDLTTKKVVDNTTAKEFADSLGVPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASG
GERPNLKIDSTPVKPASGGCC
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaaccccgaatatgactacctgtttaagctgcttttgattggtgactccggcgtgggc
aagtcgtgcctgctcctgcggtttgctgatgacacttacacagagagctacatcagcacc
atcggtgtggatttcaagattcgaaccattgagctggacggcaaaaccatcaaactgcag
atttgggacacagctggtcaggagcggttcaggaccatcacttccagctactatcgcggg
gctcatggcatcattgtggtgtatgacgtcactgaccaggagtcctacgccaacgtgaaa
cagtggctgcaggagatagatcgctacgccagtgagaatgtcaataaactcctggtaggc
aacaagagtgacctcaccaccaagaaggtcgtggacaacaccacggccaaggaatttgca
gactctctgggtgtccccttcctcgagacaagtgccaagaatgccaccaatgttgagcag
gcattcatgacaatggctgcagagatcaaaaagcggatggggccaggagcagcgtctggg
ggtgaacggcccaacctgaagatcgacagcacccctgtgaagcctgctagcggtggctgc
tgctag

DBGET integrated database retrieval system