KEGG   Mus musculus (house mouse): 76338
Entry
76338             CDS       T01002                                 
Symbol
Rab2b, 1500012D09Rik, 4930528G15Rik, A230002G14, D530043M21Rik
Name
(RefSeq) RAB2B, member RAS oncogene family
  KO
K07878  Ras-related protein Rab-2B
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    76338 (Rab2b)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    76338 (Rab2b)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    76338 (Rab2b)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    76338 (Rab2b)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase AAA_22 DAP3 TetR_C_16
Other DBs
NCBI-GeneID: 76338
NCBI-ProteinID: NP_766189
MGI: 1923588
Ensembl: ENSMUSG00000022159
UniProt: P59279 Q0PD64
Position
14:complement(52499216..52516852)
AA seq 216 aa
MTYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIKLQIW
DTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSSSNMVIMLIGNK
SDLESRRDVKREEGEAFAREHGLIFMETSAKTACNVEEAYINTAKEIYRKIQQGLFDVHN
EANGIKIGPQQSITSSVGPCSPQQNVSDIGPDSGCC
NT seq 651 nt   +upstreamnt  +downstreamnt
atgacttacgcttatctcttcaagtacatcatcatcggagacacaggtgtggggaagtca
tgtctcctccttcagtttaccgacaagcggttccagcccgtgcacgacctcacaataggt
gtggagtttggagcacgtatggtcaacatcgatggaaaacaaatcaaactgcaaatctgg
gatacggctgggcaagagtccttccgttctatcacccgttcctactacaggggagcagct
ggagccctgctggtgtatgacatcacgagacgcgaaaccttcaaccacctgacctcatgg
ttagaggacgcccgccagcactccagctccaacatggttataatgctgatcgggaataag
agtgatctagaatctcgaagggatgtgaagagagaggaaggagaggcctttgctcgtgag
cacggccttatattcatggaaacatcagccaagacagcctgcaatgttgaagaggcctac
attaatacagccaaagaaatatataggaagatccagcaaggtttatttgatgtccacaat
gaggcaaatggcatcaagattgggccccagcagtcaattacctcctcagtaggaccgtgc
tcccctcagcagaacgtttctgacatagggcctgactctggctgctgctga

DBGET integrated database retrieval system