KEGG   Mus musculus (mouse): 76408Help
Entry
76408             CDS       T01002                                 

Gene name
Abcc3, 1700019L09Rik, ABC31, MLP2, MOAT-D, MRP3
Definition
(RefSeq) ATP-binding cassette, sub-family C (CFTR/MRP), member 3
  KO
K05667  ATP-binding cassette, subfamily C (CFTR/MRP), member 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01523  Antifolate resistance
mmu02010  ABC transporters
mmu04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    76408 (Abcc3)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    76408 (Abcc3)
 09160 Human Diseases
  09176 Drug resistance: Antineoplastic
   01523 Antifolate resistance
    76408 (Abcc3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    76408 (Abcc3)
Transporters [BR:mmu02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    76408 (Abcc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 MMR_HSR1 RsgA_GTPase AAA_25 AAA_7 dNK RNA_helicase Dynamin_N AAA_PrkA Zeta_toxin AAA
Motif
Other DBs
NCBI-GeneID: 76408
NCBI-ProteinID: NP_083876
MGI: 1923658
Ensembl: ENSMUSG00000020865
Vega: OTTMUSG00000001891
UniProt: B2RX12 A0A0R4J015
Position
11; 11 D
AA seq 1522 aa AA seqDB search
MDRLCGSGELGSKFWDSNLSIYTNTPDLTPCFQNSLLAWVPCIYLWAALPCYLFYLRHHQ
LGYIVLSWLSRLKTALGVLLWCVSWVDLFYSFHGLIHGSSPAPVFFVTPLVVGITMLLAT
LLIQYERLRGVQSSGVLIIFWLLCVICAIIPFRSKILSALAEGKILDPFRFTTFYIYFAL
VFCALILSCFKEKPPLFSPENLDTNPCPEASAGFFSRLSFWWFTRLAILGYRRPLEDRDL
WSLSEEDCSHKVVQRLLEAWQKQQNQASRSQTATAEPKIPGEDAVLLKPRPKSKQPSFLR
ALVRTFTSSLLMSACFNLIQNLLGFVNPQLLSILIRFISDPTAPTWWGFLLAGLMFLSST
MQTLILHQYYHCIFVMALRLRTAIIGVIYRKALVITNSVKRESTVGEMVNLMSVDAQRFM
DVSPFINLLWSAPLQVILAIYFLWQILGPSALAGVAVIVLLIPLNGAVSMKMKTYQVKQM
KFKDSRIKLMSEILNGIKVLKLYAWEPSFLEQVKGIRQSELQLLRKGAYLQAISTFIWIC
TPFLVTLITLGVYVYVDESNVLDAEKAFVSLSLFNILKIPLNMLPQLISGLTQASVSLKR
IQDFLNQNELDPQCVERKTISPGYAITIHNGTFTWAQDLPPTLHSLNIQIPKGALVAVVG
PVGCGKSSLVSALLGEMEKLEGVVSVKGSVAYVPQQAWIQNCTLQENVLFGQPMNPKRYQ
QALETCALLADLDVLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDANIFLLDDPLSAV
DSHVAKHIFDQVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLAGGQVSEMGHYSALLQH
DGSFANFLRNYAPDEDQEDHEALQNANEEVLLLEDTLSTHTDLTDNEPAIYEVRKQFMRE
MSSLSSEGEVQNRTMPKKHTNSLEKEALVTKTKETGALIKEEIAETGNVKLSVYWDYAKS
MGLCTTLSICLLYGGQSAAAIGANVWLSAWSNDAEEHGQQNKTSVRLGVYAALGILQGLL
VMLSAFTMVVGAIQAARLLHEALLHNKIRSPQSFFDTTPSGRILNRFSKDIYVIDEVLAP
TILMLLNSFFTSISTIMVIVASTPLFMVVVLPLAVLYGFVQRFYVATSRQLKRLESISRS
PIFSHFSETVTGTSVIRAYGRIQDFKVLSDTKVDNNQKSSYPYIASNRWLGVHVEFVGNC
VVLFAALFAVIGRNSLNPGLVGLSVSYALQVTMALNWMIRMISDLESNIIAVERVKEYSK
TKTEAPWVVESNRAPEGWPTRGMVEFRNYSVRYRPGLELVLKNVTVHVQGGEKVGIVGRT
GAGKSSMTLCLFRILEAAEGEIVIDGLNVAHIGLHDLRSQLTIIPQDPILFSGTLRMNLD
PFGRYSEEDIWRALELSHLNTFVSSQPAGLDFQCAEGGDNLSVGQRQLVCLARALLRKSR
VLVLDEATAAIDLETDDLIQGTIRTQFEDCTVLTIAHRLNTIMDYNRVLVLDKGVVAEFD
SPVNLIAAGGIFYGMAKDAGLA
NT seq 4569 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcctgtgcggctccggagagctgggctccaagttctgggactccaacctgtct
atatataccaacactccggacctcacaccctgtttccagaactccttgctggcctgggtc
ccctgcatctacctgtgggctgccttgccctgctacctgttttacctgagacaccatcag
ctcggctacatagtcctctcatggttatccaggctcaagacggccctcggtgttctgctg
tggtgtgtctcatgggtggacctgttctattccttccacggcctgatccatggctcatcc
cctgctcctgtcttctttgtcacacccttggtggtggggatcaccatgctgctggccact
ttgctaatccagtacgagcggcttcggggggtacagtcttcgggagtgctcatcatattc
tggctcctgtgtgtgatctgtgccatcatccccttccgttccaagatcctctcagctttg
gcagagggtaaaatcttggatccgttccggttcaccactttctacatctactttgccctg
gtgttctgtgccctcatcctgtcctgcttcaaggagaagccgcctttgttctccccggag
aatcttgacacaaatccttgcccagaggccagcgctggcttcttttcccgcttgtctttc
tggtggttcacaaggcttgccatccttggctaccgacgtcccctggaggaccgtgacctc
tggtctctgtctgaggaggactgctctcacaaggtggtacaacggctgctggaagcatgg
caaaagcagcagaaccaagcatcaaggtcccagacggcaacagctgagccaaagatccca
ggtgaggatgcggtcctactgaagccccgacccaagtccaagcagccttcctttctgagg
gctttggtgagaaccttcacctccagcttgctcatgagtgcctgtttcaacctgatccag
aacctactcggcttcgtcaacccacagctgctcagtatactcatcaggtttatttctgac
cccacggcccccacctggtggggcttcttgctggccggactgatgttcctgagctccacc
atgcagacattgatcttacaccaatattaccactgcatctttgtgatggccttgaggcta
cggactgctattataggtgtcatctacaggaaggctctggtcatcaccaactcagtcaaa
cgggagtccactgtgggagaaatggtcaacctcatgtcagtggatgctcagcgcttcatg
gatgtctcccctttcatcaatctgctgtggtctgcacctttgcaggtcatcctggcaata
tacttcctctggcagatcctgggcccatcagctctggctggagtggctgtgatagtcttg
ctgataccactcaatggagctgtgtccatgaagatgaagacctaccaggtaaagcaaatg
aagttcaaggactcccgcatcaagctgatgagcgagatcctgaacggcatcaaagtgctc
aagctgtacgcttgggagcccagcttcttggagcaggtgaaagggatcaggcagagtgaa
cttcagctgctccggaagggggcctacctgcaggccatctccaccttcatctggatctgc
accccatttctggtgaccctgatcaccctcggagtgtacgtgtatgtggacgagagcaat
gtactggatgccgagaaggcctttgtgtccctgtctttgttcaatatcttaaagatcccc
ctcaacatgctgcctcagttaatcagtggactgacccaggccagcgtgtctctgaaacgg
atccaggatttcctgaaccaaaatgaacttgacccccaatgtgtggaaagaaagaccatc
tccccaggctacgccatcaccatacacaacggcaccttcacctgggcccaggacctgccg
cccaccctgcacagcctaaacattcaaatcccgaagggggcattggtggctgtggtggga
cctgtgggctgtgggaagtcttctctggtgtctgccttactcggagagatggagaagctg
gaaggtgtggtgtctgtaaagggctctgtggcctacgtgccccagcaggcatggatccag
aactgcacacttcaggaaaatgtgctatttggccaacccatgaaccccaagcgctaccaa
caggctctggagacatgtgccctgctagctgacctagatgtgcttcctggtggggaccag
acagagattggagagaagggtattaacctatctggaggccagcgccaacgggtgagtttg
gcccgagctgtttatagtgatgccaacatttttttgctggatgacccactgtcggctgtg
gactctcatgtggcgaagcatatcttcgaccaagtgattggaccagaaggtgtgctggca
ggcaagactcgggtgctggtaactcatggcatcagcttcctgccccagacggactttatc
attgtgcttgctggtggacaggtgtctgagatgggccactactcggccctcctgcagcat
gatggctcctttgccaacttcctccgaaactacgcaccagatgaagaccaggaggaccat
gaagccttgcaaaatgcaaatgaggaggtactcctgctcgaagacacactcagcacccac
acagacctgacagacaatgagccagccatctacgaggtccgcaagcagttcatgagagag
atgagctccttgtcttctgaaggggaggtccagaaccggactatgcccaagaaacacaca
aattcattggagaaggaggcgctggtgacaaagactaaggagactggcgcattaatcaaa
gaggagatagcagagacaggcaatgtgaagctgagtgtgtactgggattatgccaagtct
atgggactctgtaccacgctatctatctgcctcctgtatggtggccaaagcgcagctgct
atcggagccaatgtgtggctcagcgcctggagcaatgatgcggaggaacatggccagcag
aacaagacctccgtaaggctcggtgtctacgccgccctagggatactgcaagggctcctg
gtcatgctgtcagctttcaccatggtggtcggcgcgatccaggctgcccgcctgctgcac
gaagctctgctgcacaacaagattcgttcccctcagtccttctttgacaccacgccctcg
ggccgcatcctcaaccgtttctccaaggacatatacgtcatcgacgaggttctggccccc
accatcctcatgctgttgaattccttcttcacatccatctccaccatcatggtcatcgtg
gccagcacgccgctcttcatggtggttgtcttgcccctggctgtgctctatggctttgtg
cagcgcttctatgtggccacatcacggcagctcaagcggctggaatccatcagccgctca
cccatcttctcccacttttcggagacagtaacgggcaccagtgtcattcgggcctatggc
cgaatccaagacttcaaggtcctcagtgatactaaggtggacaacaaccagaaaagcagt
tatccctacattgcctccaatcgatggctgggggtccacgtggagtttgtggggaactgc
gtggtgctctttgccgcactgtttgcagtgatcgggagaaacagcttgaatccagggctt
gtgggtctttctgtgtcctatgccttacaggtgaccatggctttgaattggatgatacga
atgatatccgacttggagtctaatatcatagctgtggagagagtcaaggagtactctaag
accaagactgaggccccctgggtggtggagagcaaccgcgccccggaaggctggcccacg
cgaggaatggtggagttccggaactattcagtgcggtaccggcctggcctcgagttggtg
ctgaagaacgtgactgttcatgtgcagggtggggagaaggtaggcattgtgggccgcact
ggggctggcaaatcttccatgactctttgcctgttccgaatcctggaggccgcagagggt
gagatcgtcattgatgggctcaacgtggcacacattggcctccacgacctgcgctctcag
ctcaccatcatccctcaggaccccatcctgttctcgggcaccctgcgtatgaacttagat
ccctttggccgatactcggaggaggacatctggagggccctggagctatcccacctgaac
acgttcgtgagcagccagccagcaggcctggatttccagtgcgctgagggtggggataat
ctcagtgttggccagaggcagcttgtatgcctagcccgagccctgctccggaagagccga
gtcctggttttagacgaggccactgctgccattgacttggagacggatgacctcatccag
ggcaccatccgtacccagtttgaagactgcaccgtactgaccatcgcccaccggctcaac
acaatcatggactacaacagggtcctggtcttggacaaaggagtagtagctgaatttgat
tctccagtcaacctcattgcggccggaggcatcttctatgggatggccaaggatgcggga
cttgcctag

DBGET integrated database retrieval system