KEGG   Mus musculus (mouse): 76416
Entry
76416             CDS       T01002                                 

Gene name
Polr1has, 1700022C21Rik, AI746295, Znrd1-as, Znrd1as
Definition
(RefSeq) RNA polymerase I subunit H, antisense
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF5520 PRIMA1 DUF4131
Other DBs
NCBI-GeneID: 76416
NCBI-ProteinID: NP_083878
MGI: 1923666
Ensembl: ENSMUSG00000036214
Vega: OTTMUSG00000037386
UniProt: Q8R0E5 A0A0R4J0L3
Position
17; 17 B1
AA seq 292 aa
MTSTKLRLAWAKESRDPRISEGQQSPLEKKILSFGGVHTTAARHLITQKCHEESKALCKE
QANSLDYWLAKAESYYNKRMVERMKKDTGDETKTKVQEEPPSPSPPPPPPPRRERQKQHY
WVPEREKKQIERHIHRTSHAREFTDKPWRQPRLFSETTLPKIVLEEESIPQAQKRRQAHE
RELLQIKDHRERMIRGRELLQQRLKDRILRKSPSQIPLPEKRDQVKKQKKEFEKVVAYPL
VQPSCTSRIKVDVLMEKSQDEEDLSTIIKPFGRRFLAVPPFLRTQIGKIKDL
NT seq 879 nt   +upstreamnt  +downstreamnt
atgacgtcgactaagttaagattggcttgggcaaaagaatccagagaccctaggatttca
gaaggccagcagtctccactggagaagaagatcctgagttttggtggtgtgcatacaaca
gcagcaagacacttgataactcagaaatgccatgaggagagcaaagcactctgcaaggag
caagctaattctctggactactggcttgcaaaagcagagtcgtattataataagagaatg
gtggagagaatgaaaaaagacacaggtgatgaaacaaagacaaaagtgcaagaggaacca
ccatcaccatcaccaccaccaccaccaccaccacgcagagagagacagaaacagcattac
tgggtgcctgagagagagaagaagcaaatagaaaggcacattcatagaacaagccatgcc
agagaatttacagacaaaccctggagacagccacgactcttcagtgaaacaacactaccc
aaaattgtgctagaggaggaaagcatcccacaagcacagaaaagaaggcaggcacacgag
agagaactgctccaaattaaagatcaccgggagcgcatgattcgagggagggaacttcta
cagcaaaggctcaaagacagaatcttgagaaaaagcccgagtcagatcccacttcctgag
aagcgtgatcaagtgaagaaacagaaaaaagagtttgagaaggtagttgcatacccacta
gtccagccatcctgtaccagtaggattaaagtagatgttcttatggaaaaatctcaggat
gaagaggacttgagcacaattataaaaccttttggaaggagattcttagctgtaccaccc
tttttgagaactcaaataggaaaaataaaggatctgtaa

DBGET integrated database retrieval system