KEGG   Mus musculus (house mouse): 76425
Entry
76425             CDS       T01002                                 
Symbol
Gid8, 2310003C23Rik, 4833420G11Rik, AI451474, Twa1
Name
(RefSeq) GID complex subunit 8
  KO
K23338  glucose-induced degradation protein 8
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    76425 (Gid8)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   CTLH complex
    76425 (Gid8)
SSDB
Motif
Pfam: CTLH LisH DUF4434 EAD11
Other DBs
NCBI-GeneID: 76425
NCBI-ProteinID: NP_001276580
MGI: 1923675
Ensembl: ENSMUSG00000027573
UniProt: Q9D7M1
Position
2:180351874..180363392
AA seq 228 aa
MSYAEKPDEITKDEWMEKLNNLHVQRADMNRLIMNYLVTEGFKEAAEKFRMESGIEPSVD
LETLDERIKIREMILKGQIQEAIALINSLHPELLDTNRYLYFHLQQQHLIELIRQRETEA
ALEFAQTQLAEQGEESRECLTEMERTLALLAFDSPEESPFGDLLHMMQRQKVWSEVNQAV
LDYENRESTPKLAKLLKLLLWAQNELDQKKVKYPKMTDLSKGVIEEPK
NT seq 687 nt   +upstreamnt  +downstreamnt
atgagttatgcagaaaagccggatgaaataaccaaagatgaatggatggaaaagctcaat
aacttgcatgttcaacgagcagacatgaaccgactcatcatgaactacctagtcacagag
ggctttaaggaagcagcagagaaatttcggatggagtctgggatcgaaccaagtgtggac
ctagaaacacttgatgagcgaatcaagattcgggagatgattctgaagggtcagatccag
gaggccattgccttgatcaacagcctccacccagagctcctagacacaaaccggtatctt
tacttccaccttcagcaacaacacttgattgagcttatccgtcagcgtgagacagaagca
gcattggagtttgcccagacacaactggcagagcagggtgaggaaagccgagaatgcctc
acagagatggagcgcacactggccttgctggccttcgatagccctgaggagtcgcctttt
ggagacctccttcacatgatgcagaggcaaaaggtatggagtgaagttaaccaggctgtt
ctggattatgagaatcgagagtccacacccaagctggcaaaattactgaaactgctactt
tgggctcagaatgagctagaccagaagaaagtaaaatatcccaaaatgacagacctcagc
aaaggtgtgattgaggagcccaagtag

DBGET integrated database retrieval system