KEGG   Mus musculus (mouse): 76438
Entry
76438             CDS       T01002                                 

Gene name
Rftn1, 2310015N21Rik, AI853526
Definition
(RefSeq) raftlin lipid raft linker 1
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: Raftlin DUF4177
Other DBs
NCBI-GeneID: 76438
NCBI-ProteinID: NP_852062
MGI: 1923688
Ensembl: ENSMUSG00000039316
Vega: OTTMUSG00000023326
UniProt: Q6A0D4
Position
17; 17 C
AA seq 554 aa
MGCSLNKLEKREEKRPGNIYSTLKRPQVETKVDVTYEYCFLEFTTLTAAELPRSSATRLA
SLRDLPDQLLELYQQGFSLAALHPFVQPTRRQEKILLEHIFRAILVKKTNRSQKAELHDE
GYTLELDYCSSLEHLADQKLIPEFIKKVQEAASQGLKFVSVVPQYQPSVSSAGSRRLKPV
ANSVEDARDVKCTLGDRSSLENDTPKAAETDAATAGVNRRPETKPGSTGDVPSAQQPGIP
SPSAENEAGEFPLRGLQPALDRSEGDPSNGPEELPSRKMEIFAFFNRPKSQQKCRQYYPV
TIPLQVSKNGQTVSSLDASWLEHMSDHFRKGGVLVNAVFQLGMANDSFYGLTDGVFIFEA
VSTEDNRTTQGYDAIVVEQWTVLEGTEVQTDYMPLLNSLAAYGWQLTCVLPTPILKTTRE
GNVSTKQIVFLQRPCLPQKTKKRESKFQWRFSRNEIHGRQTRKSKGKLSASNKQQAEENE
KNLEDQFSKAGDVGNCVLGAPQWGRASEVREQRQGSAAVQNGPAGHNRDSVALRHSNPRA
EAELAAGPTPTEAN
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgggttgcagtttgaacaagctggagaaacgtgaagaaaagcggcctgggaacatttat
tcaactctgaagagacctcaggtggagaccaaagtagatgtgacctatgagtactgcttt
ctagagttcaccacactgactgccgcggagctgccgagatcctccgccacgaggttagcc
tctctgcgggacctgcctgaccagcttctggagctgtaccaacaaggcttctcactggcc
gccctgcacccatttgtgcagccaacccgcaggcaagagaagatcctcctggaacacatc
tttcgggccatcctggtcaagaaaaccaacaggtctcagaaggctgagcttcacgacgaa
ggctacaccctggaattggattactgctcctccttagaacacctggccgaccagaagctc
atcccagagttcattaagaaggtgcaggaggccgccagtcagggcttgaagtttgttagc
gtggtgccccagtaccagccctcggtgagctcagcaggcagccggcgtctcaagcctgtt
gccaacagtgttgaagatgccagggatgtgaaatgcaccttaggggaccgttcatccttg
gaaaatgatactccgaaggctgcagagacggatgctgccactgcaggagtgaaccgaaga
ccggagaccaaaccaggatccacaggggacgtgcccagtgcccagcagcctggcattccc
tctccctcggcagagaatgaggctggcgagtttccactgcggggtttgcagccagcactg
gatagatcagagggcgacccctcaaatgggcctgaagagctgccctccaggaagatggag
atcttcgcctttttcaacagaccgaagagccagcagaaatgtcggcagtactaccctgtc
accatccccctccaggtctccaagaacggccagacagtgagcagtctagacgccagctgg
ctggaacacatgagtgaccatttccggaaaggcggtgtgctggtgaacgccgtcttccag
cttggcatggccaatgattccttctatggcctgacagatggagtattcatctttgaagct
gtttccacagaagataacagaaccacacagggctatgacgctattgttgtggaacaatgg
acagtcctagaaggtacagaggtacagaccgactacatgcccctgctgaactcgctggcg
gcctacggatggcagctcacctgtgtgctgccaacgcctatactcaagactaccagggaa
gggaacgtgtccaccaagcagattgtgtttcttcagagaccatgtctacctcagaaaacc
aagaagagggaatctaagttccagtggcgattctcccggaacgagatccacggcaggcag
acaaggaaatccaaagggaaactcagtgccagcaacaagcagcaagcagaagagaatgag
aagaatctggaagaccagttctccaaggctggagatgtgggaaactgtgtgctgggggca
ccgcagtggggcagagcctctgaggtcagggagcaaaggcagggctcagcagctgtgcag
aatggtcccgctggccacaacagggactcggtggcccttaggcactcgaatcccagagct
gaggctgagcttgctgcaggccccactccaacagaagcaaattga

DBGET integrated database retrieval system