KEGG   Mus musculus (house mouse): 76441
Entry
76441             CDS       T01002                                 
Symbol
Daam2, 2310016D11Rik
Name
(RefSeq) dishevelled associated activator of morphogenesis 2
  KO
K04512  dishevelled associated activator of morphogenesis
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    76441 (Daam2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    76441 (Daam2)
   04147 Exosome [BR:mmu04147]
    76441 (Daam2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Formins
     76441 (Daam2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   76441 (Daam2)
SSDB
Motif
Pfam: FH2 Drf_FH3 Drf_GBD Mito_fiss_reg
Other DBs
NCBI-GeneID: 76441
NCBI-ProteinID: NP_001008232
MGI: 1923691
Ensembl: ENSMUSG00000040260
UniProt: Q80U19
Position
17:complement(49763050..49871517)
AA seq 1115 aa
MALRKRSPHGLGFLCCFGGSDLPEIDLRDSHPLQYLEFSGPIPNPEELNVRFAELVDELD
LTDKNREAVFALPPEKKWQIYCSKRKEQEDPNKLATSWPEYYIDRINAMAAMQNLYETED
EETDKRNQVVEDLKTALRTQPMRFVTRFIDLEGLTCLLNFLRGMDHTTCESRIHTSLIGC
IKALMNNSQGRAHVLAQPEAISIIAQSLRTENSKTKVAVLEILGAVCLVPGGHKKVLQAM
LHYQAYAAERTRFQTLLNELDRSLGRYRDEVNLKTAIMSFINAVLNAGAGEDNLEFRLHL
RYEFLMLGIQPVIDKLRQHENAILDKHLDFFEMVRNEDDLELARRFDMVHIDTKSASQMF
ELIHKKLKHTEAYPCLLSVLHHCLQMPYKRNGGYFQQWQLLDRILQQIVLQDERGVDPDL
APLENFNVKNIVNMLINENEVKQWRDQAEKFRKEHMELMSRLERKERECETKTLEKEEMM
RTLNKMKDKLARESQELRQARGQVAELVARHNESSTGPVSSPPPPGGPLTLSSSRTTNDL
PPPPPPLPFDSCPPPPAPPLPPGGPPIPPGAPPCFSSGPPPSHDPFSSNEAPLRKKRIPQ
PSHPLKSFNWVKLNEERVSGTVWNEIDDSQVFRILDLEDFEKMFSAYQRHQACMQEGPQR
ERGNVRDGGAASRPLPAVEASAHRTEKASRSMVSATGAKKELGSTEDIYITSRKVKELSV
IDGRRAQNCIILLSKLKLSNDEIRQAILRMDEQEDLAKDMLEQLLKFIPEKSDIDLLEEH
KHEIERMARADRFLYEMSRIDHYQQRLQALFFKKKFQERLAEAKPKVEAILLASRELTLS
QRLKQMLEVVLAIGNFMNKGQRGGAYGFRVASLNKIADTKSSIDRNISLLHYLIMILEKH
FPDILNMPSELKHLSEAAKVNLAELEKEVSILRRGLRAVEVELEYQRHQARDPNDKFVPV
MSDFITVSSFSFSELEDQLNEARDKFAKALTHFGEQESKMQPDEFFGIFDTFLQAFLEAR
QDLEAMRRRKEEDERRARMEFMLKEQREKERWQRQRKVLAGGALEESGEFDDLVSALRSG
EVFDKDLSKFKRNRKRPGSQVPEVTRERAINRLNY
NT seq 3348 nt   +upstreamnt  +downstreamnt
atggccctccgcaagaggagtcctcatggcctgggcttcctttgctgctttggaggcagt
gaccttcccgagatcgacctccgggacagccacccactgcagtatctggagttctccggt
cccatcccgaatcctgaggagctcaatgtccgctttgcagagctggtggatgaattggac
ctcacagataaaaaccgagaggctgtgtttgcactaccacccgagaagaaatggcagatc
tactgcagcaagaggaaggagcaggaggatcccaacaagctggcaaccagttggcctgag
tactacattgatcgtatcaatgccatggccgccatgcagaatctgtatgaaactgaagat
gaggagacagacaagaggaaccaagttgtagaagacctgaagacagccctccggacacaa
cccatgaggtttgtgacccgcttcatcgatctggaaggcctgacctgtctgctgaatttc
ctccggggcatggaccacaccacctgtgaaagccgcatccacacatctctcattggctgc
atcaaggctctgatgaacaactctcagggccgggcacacgtcctggcacaacctgaggcc
atcagcatcatcgctcagagcctgcgcacagagaacagcaagaccaaagttgcagtgctg
gagatcctgggtgcagtgtgccttgtacccggaggccacaagaaggttctacaggccatg
ctacactatcaggcgtatgcagccgagcgcactcgtttccagactttgctgaatgaactg
gatcgaagcttaggccgctaccgggatgaggtaaacctgaagacagccatcatgtccttc
atcaatgctgtcctcaatgctggcgctggagaggataacctggaattccgcctgcatctc
cggtatgagttcctgatgctggggatccagccagtgattgataaactccggcaacacgag
aatgccatcctggacaagcatttagacttctttgagatggtccggaatgaggatgacctg
gagctagccaggaggtttgacatggtccacattgacacaaaaagtgcctcccagatgttt
gagctgatccacaagaagctgaagcacacggaagcctatccctgcctgctctctgtcctg
caccactgcctgcagatgccctacaagcggaatggtggctacttccagcagtggcagctc
ctggaccgaatccttcaacagattgtcctccaggatgagcgaggggtggaccctgacctg
gccccactggaaaactttaatgtcaagaacatcgttaacatgctcatcaatgagaatgag
gtgaagcagtggagggaccaggcagagaagtttcggaaagaacacatggaactcatgagc
cggctggagagaaaagagcgggaatgtgagacaaagacactggagaaggaggagatgatg
cggacgctcaacaagatgaaggacaaactggcccgcgagtcccaggagctgcgccaagct
aggggacaagtggcagagctggtagcccgacataatgagagctcaaccggcccggtgtcc
tccccacctccccctggaggtccactcaccttgtcttcctccaggacaaccaatgatctg
cctccacccccaccacctctcccctttgatagctgcccacccccacccgcaccacccctc
cctcccggagggcctcccatccccccaggtgccccaccctgcttcagctcaggcccaccc
ccatctcatgaccccttctccagcaatgaagccccactcaggaaaaagcgcattccccag
ccttcacacccactgaagtccttcaactgggtcaagctgaatgaggagcgtgtttctggc
accgtgtggaatgaaattgatgactcgcaggtatttcggattctggacctggaagacttt
gaaaaaatgttctcggcatatcagaggcaccaggcttgcatgcaggaggggccccagaga
gagagaggaaatgtgagagacggaggggcggcgagcagacctctgccagctgtggaggcg
agtgcccacagaactgagaaggcttctaggtctatggtatcagctacaggtgccaagaaa
gaactgggctccacggaggacatctacataacctcccgcaaggttaaagagctgtcagtc
atcgatggccggagggcccagaactgtatcattcttctctccaagctgaagctttctaat
gatgaaatacggcaggccatcttgcggatggatgaacaagaagacctcgctaaggacatg
ctggagcagcttctcaagttcatccccgagaagagcgacattgatctcctagaagagcac
aaacatgagattgagaggatggcgcgtgcagatcgcttcctctatgaaatgagcaggatc
gaccattaccagcaacggctacaggccctgttcttcaagaagaagttccaggaacgcctg
gctgaggccaagcccaaagtagaagccatcctgctggcctcccgggagctgactctcagc
cagcgcctgaagcaaatgctggaggtggtcctagccatcggcaacttcatgaacaagggg
cagcgtggcggtgcctatggcttccgggtagccagtctcaacaagatcgctgacaccaag
tccagcattgacaggaacatctctctgcttcattacctgatcatgatcctggagaagcac
ttcccagatatcctgaacatgccctcagagctaaagcacctatcagaagctgccaaagtc
aacctggcagagctggagaaggaggtgagcattctcaggagaggcctccgagcagtggaa
gtggagttggaatatcagagacaccaggcacgagaccccaatgacaagttcgtccctgtc
atgagtgacttcatcacagtgtctagcttcagcttctcagagctggaggaccagctgaat
gaggccagggacaagtttgccaaggcactgacacatttcggagagcaggagagtaagatg
caaccggatgaattctttggcatcttcgacaccttcctgcaggccttcttggaggcccgg
caggacctggaggccatgcggaggaggaaggaggaagatgagcggagagcacgtatggaa
ttcatgttgaaggaacagcgtgagaaagagagatggcagaggcagaggaaggtcttggct
ggcggcgccctggaggagagcggcgagtttgatgacctagtgtcagccctgcgctctgga
gaagttttcgataaggacttaagcaagttcaagcgcaaccggaagcggcccgggagccag
gttccggaggtcacccgcgagcgggccataaacaggctaaattattga

DBGET integrated database retrieval system