KEGG   Mus musculus (house mouse): 76457
Entry
76457             CDS       T01002                                 
Symbol
Ccdc134, 2310042L06Rik
Name
(RefSeq) coiled-coil domain containing 134
  KO
K25417  coiled-coil domain-containing protein 134
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    76457 (Ccdc134)
SSDB
Motif
Pfam: ERK-JNK_inhib
Other DBs
NCBI-GeneID: 76457
NCBI-ProteinID: NP_766016
MGI: 1923707
Ensembl: ENSMUSG00000068114
UniProt: Q8C7V8
Position
15:82012101..82026404
AA seq 229 aa
MDLLQFLAAFSVLLWPGTEVTGALKSTLDPSLKIYKKMFEVKRREQLLALKNLAQLNDIH
QQYKILDVMLKGLFKVLEDSRTVLIAADVLPDGPVPQDEKLKDAFSHVVENTAFFGDVVL
RFPKIVHHYFDHNSNWNLLIRWGISFCNQTGVFDQGPHSPILSLMAQELGITEKDSDFRN
PFKTDQTEFIPSTDPFQKALREEEKRRKKEERRKEIRKGPRISRSQSEL
NT seq 690 nt   +upstreamnt  +downstreamnt
atggaccttcttcagttcctggcagccttctctgtcctcctgtggcctggcacggaagtc
acaggcgccctgaagagcactctggacccgagcctcaagatttacaagaagatgtttgag
gtgaagcggcgagagcagctgttggcactgaagaacctggcgcagctgaatgacatccac
cagcagtacaagatcctggatgtcatgcttaagggactcttcaaggtgctggaggactcc
cgcacagtgctcattgctgccgatgtgcttccagacgggccggtcccccaggatgagaag
ctgaaggatgctttctcgcacgtggtggagaacacagccttttttggtgacgtcgtgctg
cgcttcccaaagattgtccaccactactttgaccataattccaactggaacctcctgatc
cgctggggcatcagcttctgcaaccagacaggcgtctttgaccaggggccccactcaccc
atcctcagcctgatggcccaggagctggggatcactgagaaagattctgacttccggaac
ccgtttaaaacagaccagacagagtttattcctagcaccgaccctttccagaaggctttg
agggaagaagaaaaacgccgcaagaaggaggagaggcggaaggagatccggaaaggcccg
aggatttcaagatcccagtctgagttgtag

DBGET integrated database retrieval system